KEGG   Streptomyces coelicolor: SCO3196Help
Entry
SCO3196           CDS       T00085                                 

Gene name
SCE22.13c
Definition
(RefSeq) fructose-specific permease
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
sco  Streptomyces coelicolor
Pathway
sco00051  Fructose and mannose metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco02060  Phosphotransferase system (PTS)
Module
sco_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO3196 (SCE22.13c)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SCO3196 (SCE22.13c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO3196 (SCE22.13c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     SCO3196 (SCE22.13c)
Transporters [BR:sco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    SCO3196 (SCE22.13c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-GeneID: 1098630
NCBI-ProteinID: NP_627410
Kitasato: SCO3196
UniProt: Q9KYU9
Position
complement(3502247..3504346)
Genome map
AA seq 699 aa AA seqDB search
MSDMITADLVDLDLSADTKQAATRALAERMVALGRVTDLEGFLADVAAREAQMPTGLDGG
IGIPHCRSGHVTEPTLAFGRSTAGVDFGAADGPADLIFLIAAPAGADDAHLTILSSLARR
LMNAGFTAALRSLGEPAAAAALIRGEEPTPAADTGEDSTEDVVEDTTEETADTGAVSAAA
SAEAAPGSTGEDSGGPGRPFRIVAVTSCPTGIAHTYMAAESLEHAGREAGVEVVVETQGS
AGFTRLDPAVIAAADGVILAHDVAVREKGRFAGKPTVDTGVKAAINRPGELIGEVRDKAA
RGEVTSASPGATPVERGGESGEGYGTKLRKWLMSGVSYMVPFVAAGGLLIALGFAIGGYE
INKAPSVMDHFVWTQADSWAALLFQIGGVAFAFLVPVLAGYIAYGMADRPGLVPGFVGGS
IALTINAGFLGGLAAGLISGAVVLAIQRVPIPKALRGIMPVVVIPLVSAAVVGFLMFVVI
GKPIASAQSGMTDWLNGLSGANAVLLGALLGLMMCFDLGGPVNKVAYTFATAGIAVASPS
DSAMKIMAAVMAAGMVPPLAMALATTVRGRLFNAAERENGKAAWVLGASFISEGAIPFAA
ADPLRVIPSSMVGGAVTGALSMAFGATLRAPHGGIFVVPLIGNPLLYLVAVAAGVCVTTA
LVIVLKGLRKTVPPAAAQGPGGGADPSSRAPGAKQAVAA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatgatcaccgcggacctggtcgacctcgacctgtccgccgacaccaagcag
gcggcgacgcgcgccctggcggagcggatggtggccctgggccgggtgaccgacctggag
ggcttcctcgccgacgtggccgcccgtgaggcgcagatgccgaccggcctcgacggcggg
atcggcatcccgcactgccgcagcgggcacgtcaccgagccgacgctcgcgttcggacgc
agcacggccggcgtcgacttcggggcggcggacggaccggccgacctgatcttcctcatc
gccgctccggcgggcgccgacgacgcccacctgacgatcctctcctcgctggcccgccgg
ctgatgaacgccgggttcaccgccgcgctgcgctcgctgggcgagccggcggccgccgcc
gcgctcatccgcggggaggagccgacaccggccgcggacaccggtgaggacagcaccgag
gacgtcgtcgaggacaccaccgaggagaccgcggacaccggggcggtctcggcggcggcc
tccgccgaggccgccccgggcagcaccggtgaggattccggcgggcccgggcgccccttc
cgcatcgtcgccgtcacctcctgccccaccggcatcgcgcacacctacatggcggccgag
tcgctggagcacgcgggccgcgaggcgggcgtcgaggtcgtcgtcgagacgcagggctcg
gccggcttcacccggctcgacccggcggtgatcgcggcggcggacggcgtgatcctcgcc
cacgacgtcgccgtgcgcgagaagggccgcttcgccgggaagcccaccgtcgacaccggc
gtcaaggccgccatcaaccggccgggcgagctgatcggcgaggtccgcgacaaggcggcc
cgcggcgaggtcacctccgcatccccgggcgcgacccccgtcgagcgcggcggcgagtcc
ggcgagggctacggcaccaagctccgcaagtggctgatgtccggcgtcagttacatggtc
ccgttcgtcgccgcgggcggtctgctgatcgccctgggcttcgcgatcggcggctacgag
atcaacaaggcgccctccgtgatggaccacttcgtgtggacccaggcggacagctgggcg
gcgctgctcttccagatcggcggcgtggccttcgccttcctggtcccggtgctggccggt
tacatcgcctacggcatggccgaccggccgggcctggtccccggcttcgtcggcggctcg
atcgcgctgaccatcaacgccggcttcctcggtggtctggcggccggtctgatctccggc
gcggtggtgctggcgatccagcgggtaccgataccgaaggcgctgcgcggcatcatgccg
gtggtggtgatcccgctcgtctcggcggcggtcgtcgggttcctgatgttcgtcgtgatc
ggcaagcccatcgcctccgcgcagtcgggcatgaccgactggctgaacggcctgtccggc
gccaacgcggtcctgctcggcgcgctgctcggcctgatgatgtgcttcgacctcggcggc
ccggtcaacaaggtcgcctacaccttcgccaccgcgggcatcgccgtcgccagccccagc
gactcggcgatgaagatcatggcggcggtgatggcggccggcatggtcccgccgctggcg
atggccctggccaccaccgtgcgcggccggctcttcaacgccgccgagcgcgagaacggc
aaggccgcctgggtcctgggcgcctccttcatctccgagggcgcgatcccgttcgccgcg
gccgacccgctgcgcgtcatcccgtcctcgatggtgggcggcgcggtcaccggcgccctg
tcgatggccttcggtgcgacgctgcgcgccccgcacggcggcatcttcgtggtcccgctg
atcggcaacccgctgctctacctggtcgccgtcgcggccggggtctgtgtcaccacggcc
ctggtgatcgtcctcaaggggctgcgcaagacggtgccgccggcggcggcccagggaccc
ggcgggggcgcggacccgtcgtcccgggcgccgggcgcgaagcaggcggtggccgcgtaa

DBGET integrated database retrieval system