KEGG   Streptomyces coelicolor: SCO3210Help
Entry
SCO3210           CDS       T00085                                 

Gene name
SCE8.03c
Definition
(RefSeq) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
sco02024  Quorum sensing
Module
sco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3210 (SCE8.03c)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCO3210 (SCE8.03c)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SCO3210 (SCE8.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 1098644
NCBI-ProteinID: NP_627424
Kitasato: SCO3210
UniProt: Q9Z4X1
Position
complement(3519449..3520903)
Genome map
AA seq 484 aa AA seqDB search
MTASDTYTQPRTAPAGTGTAAPGPTGPAADAGRGGWTPGSWRSRPAAQQPEWPDPGELRG
VEDTLALRPPLVLPDEILDLRRSLAQVAAGEGFLLQAGDCAERFGSCTEAGVRGKLRVIL
QVAILLTYGSGLPVVKVGRIAGQFGKPRSRPTEAVDGVELPVYRGDIVNGPEFTAEARRP
DAGRLLSAYHHASAALNVLRALTLGGYADLGQVHEWNQEFVRRSPAGQRYEKAADDITWA
LRFMSACGLDTRSQAALHQVQLYTSHEALLPQYEQALIRYDEKRRGWFDTSAHLLWIGDR
TRRVDGAHVELLAGVDNPVGVKVGPTMGVDDLRELCERLDPDRAPGRLVLISRLGAGRGA
ELLPPLLRAVRDAGHAPVWACDPMHGNTFVSASGYKTRRLSDITTEVAEFFAVHREEGLH
PGGIHLELTGDDVTECLGGDLDEVLDTHLASRYETACDPRLNAAQSIELAFGVARLLREL
RGGA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgagcgacacgtacacgcaaccccgcacggccccggccgggaccggcaccgcg
gccccgggcccgaccggccccgcggccgacgccgggcggggcggatggacccccggctcg
tggcggagccggccggccgcgcagcagcctgagtggcccgaccccggggaactgcgcggc
gtggaggacaccctcgcgctcaggccgcccctggtgctgcccgacgagatcctcgacctg
cgccgctccctggcccaggtcgccgcgggggagggcttcctgctccaggcgggcgactgc
gcggagcggttcgggtcctgcaccgaggcaggggtgcgcggcaagctgcgggtcatcctc
caggtggccatcctgctcacctacggctccgggctgccggtggtgaaggtgggcaggatc
gccggccagttcggcaagccccgcagccgccccacggaggccgtcgacggcgtcgaactg
cccgtctaccgcggggacatcgtcaacggccccgagttcaccgccgaggcccgccgcccg
gacgccggccggctgctgagcgcctaccaccacgcctcggcggccctgaacgtgctgcgg
gcgctgaccctgggcggctacgccgacctgggccaggtccacgaatggaaccaggagttc
gtccggcgcagccccgccggacagcggtacgagaaggccgccgacgacatcacctgggcc
ctcaggttcatgtccgcctgcggcctggacacccgctcccaggccgccctgcaccaggtc
cagctctacacctcgcacgaggcgctgctgccgcagtacgagcaggcgctgatccggtac
gacgagaagcggcggggctggttcgacaccagtgcgcacctgctgtggatcggcgaccgc
acccgccgcgtcgacggcgcgcacgtggaactgctcgccggggtggacaacccggtcggc
gtcaaggtggggcccaccatgggcgtcgacgacctgcgggaactgtgcgagcggctggac
cccgaccgggcgccgggccggctcgtcctgatcagcaggctcggcgccgggcgcggcgcg
gagctgctgccgccgctgctgcgggccgtgcgggacgccggacacgccccggtgtgggcc
tgcgaccccatgcacgggaacaccttcgtctccgcgagcggctacaagacccgccggctc
tcggacatcacgaccgaggtggccgagttcttcgcggtgcaccgcgaggagggcctgcac
ccgggcggcatccatctcgaactcaccggcgacgacgtcaccgagtgcctcggcggcgac
ctcgacgaggtgctggacacccacctggccagccggtacgagacggcctgcgatccccgg
ctgaacgccgcccagtcgatcgaactcgccttcggagtcgcccggttgctgcgtgagctg
cgcggcggtgcgtga

DBGET integrated database retrieval system