KEGG   Streptomyces coelicolor: SCO3211Help
Entry
SCO3211           CDS       T00085                                 

Gene name
SCE8.04c, trpC2
Definition
(RefSeq) indoleglycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3211 (SCE8.04c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SCO3211 (SCE8.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1098645
NCBI-ProteinID: NP_627425
Kitasato: SCO3211
UniProt: Q9Z4X0
Position
complement(3520900..3521676)
Genome map
AA seq 258 aa AA seqDB search
MSGILAGLVAEAESQTGRRRALRTEAKLTELAAAAPPARDFAAALREPGLAVIAEMKPRS
PSKGPLTDDYRPAELARAYQGGGAHAVSVLTHEAGFGGSPDHLAVARAACELPVLRKDFV
VDEYQILEARALGADALLLIVAALAPARLAALLARTRACGMEALVEVHDEREVDVALEAG
ADVIGVNHRDLRDFSIDRTLSARLRGRVGTGRVMVGESGVRGAPDARALEAAGVDAVLVG
ELLMRAGDPGTTIKGLVG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatcctcgccggcctcgtcgccgaggccgagtcgcagaccgggcgccggcgc
gcgctgcgcaccgaggcgaagctgaccgagctggccgccgcggcgcccccggcccgggac
ttcgccgccgcgctgcgcgaacccgggctcgcggtcatcgccgagatgaagccccgcagc
ccctccaaggggccgctcaccgacgactaccggccggccgaactggcccgcgcctatcag
ggcggcggcgcccacgccgtgtcggtgctcacccacgaggcgggcttcggcggcagcccg
gaccacctggccgtcgcccgcgcggcctgcgaactccccgtcctgcgcaaggacttcgtc
gtcgacgagtaccagatcctggaggcccgggcgctcggcgccgacgccctgctgctgatc
gtcgccgcgctcgcccccgcacggctcgccgcactcctggcccgcacccgtgcctgcggc
atggaggcgctggtcgaggtgcacgacgaacgggaagtggacgtggccctggaggcgggc
gccgacgtgatcggcgtcaaccaccgcgacctgcgggacttctcgatcgaccggaccctt
tcggcccggctgcgggggcgggtcggcaccgggcgggtcatggtcggggagagcggcgtg
cgcggcgcacccgacgcccgcgcgctggaagcggccggggtggacgcggtcctggtcgga
gaactgctcatgcgggccggtgaccccggtaccacgatcaagggactggtcggatga

DBGET integrated database retrieval system