KEGG   Streptomyces coelicolor: SCO3214Help
Entry
SCO3214           CDS       T00085                                 

Gene name
SCE8.07c, trpE2
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00405  Phenazine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
sco02024  Quorum sensing
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3214 (SCE8.07c)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SCO3214 (SCE8.07c)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO3214 (SCE8.07c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SCO3214 (SCE8.07c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 1098648
NCBI-ProteinID: NP_627428
Kitasato: SCO3214
UniProt: Q9Z4W7
Position
complement(3523296..3524831)
Genome map
AA seq 511 aa AA seqDB search
MTTHAAEAPTTDPQGAPGSQKTPDATEAEEAARATVPHRAAAAALAREHDVVPLHQEFLD
DSVSPVTAFAQLCGPDEAGFLLESVPVSGGVARYSYVGHRPVPLEPTGGDPLTALRSHLA
RSVAPVPGLPPFHGGVVGYLGYEAARHFEDLPLAAGPPPGLPESAFLAADDLVVFDHATR
RVLLMTLYRPARESYDDAVARIVRLNRALRRAPAPAAFSGRPLAAATPADHGTQGWTANL
TEAQFTERVARAREHIAAGDAFQIVLSRRLSRPLRARPTDLYRHLRATNPSPYMYHLSLG
GGRHVIGASPELLVKAEGRTVRTRPLAGTRPRHPDPAEDLRLERELRADEKERAEHVMLV
DLGRNDLGRVTEPGTVRVERLMRVERFSHVMHLSSTVRGRLAEGRDALDALRSAFPAGTL
SGAPKIRAMEIIAELEPEQRGVYGGALGFVGADGLTDFAIALRTMVVADGHVHVQAGAGI
VADSDPAAEFRETLHKSRAMLTAVRRAEAAA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacgccgccgaggcgcccacgacggacccacagggcgcaccgggctcacag
aagactccggacgcgacggaggccgaggaggccgcccgcgccaccgtcccgcaccgcgcc
gccgccgcggcactcgcccgcgagcacgacgtcgtcccgctccaccaggagttcctggac
gactcggtcagccccgtcaccgccttcgcccagctgtgcggaccggacgaggcgggcttc
ctgctggagagcgtgccggtctccggcggcgtggcacggtactcgtacgtcggtcaccga
ccggtgccgctcgagccgaccggcggcgacccgctgaccgcgctgcggtcccacctggcc
cggtccgtggcgccggtgcccggactgccgccgttccacggcggcgtcgtcggctacctc
gggtacgaggcggcccgccacttcgaggacctgcccctggccgccggaccgccgcccgga
ctgcccgagtccgccttcctcgccgccgacgacctcgtcgtcttcgaccacgcgacccgg
cgcgtcctgctgatgaccctctaccgcccggcccgcgagtcctacgacgacgccgtcgcc
cgcatcgtgcgcctcaaccgcgccctgcgccgcgcgccggcacccgccgccttctccggc
cgcccgctcgccgccgccacgccggccgaccacgggacgcagggctggaccgcgaacctc
accgaggcacagttcaccgagcgggtcgcccgcgcccgggagcacatcgcggccggtgac
gccttccagatcgtgctctcccggcggctcagcaggccgctgcgcgcccggccgaccgac
ctgtaccggcacctgcgggccaccaacccctcgccgtacatgtaccacctgagcctggga
ggaggccggcacgtgatcggcgcctcgcccgagctgctcgtcaaggcggagggccggacg
gtgcgcacccggcccctcgcgggcacccggccccgccaccccgaccccgccgaggacctg
cggctggagcgggagctgcgcgccgacgagaaggaacgcgccgaacacgtcatgctggtc
gacctcggtcgcaacgacctgggccgggtcaccgagccgggcacggtccgggtggagcgg
ctgatgcgggtcgagcgcttctcccacgtgatgcacctgtcgtccaccgtgcgcggacgg
ctcgccgagggccgggacgcgctggacgccctgcgctcggccttccccgccggaacgctc
tccggggcgcccaagatccgggccatggagatcatcgccgagctggagcccgagcagcgc
ggggtgtacggcggcgccctcggcttcgtcggcgcggacggtctgaccgacttcgccatc
gccctgcgcaccatggtcgtcgccgacggccacgtgcacgtgcaggcgggcgccgggatc
gtcgccgactccgaccccgcggccgagttccgcgagaccctgcacaagtcgcgcgccatg
ctcacggccgtacggcgggcggaggcggcggcatga

DBGET integrated database retrieval system