KEGG   Streptomyces coelicolor: SCO3221Help
Entry
SCO3221           CDS       T00085                                 

Gene name
SCE8.14c
Definition
(RefSeq) prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00401  Novobiocin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3221 (SCE8.14c)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO3221 (SCE8.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SCO3221 (SCE8.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH DAO F420_oxidored CoA_binding_2 FAD_binding_3 3HCDH_N NAD_binding_2 ApbA Pyr_redox_2 FAD_binding_2 Pyr_redox AdoHcyase_NAD CbiG_N
Motif
Other DBs
NCBI-GeneID: 1098655
NCBI-ProteinID: NP_627435
Kitasato: SCO3221
UniProt: Q9Z4W3
Position
complement(3533492..3534346)
Genome map
AA seq 284 aa AA seqDB search
MRSVVIVGAGVIGRSVGLALRRHGVTTYLTDADPEAALAGERCGAGFAAPPPRQADIAVL
AVPPDQVAPVLAEHQKLGTARCYTDVSGVKVRLHREVRAHGCDLTSLVSGAPVVGGSGPV
QARADLFDGRPWALTPTEATGNLALNCALELVALCGAVSVLLDPETHDRAVALVSHAPHL
VASLVAARLLGGDESAVRLAGQDLRDVTRTADANPERWARILTANAGPVADQLDDWAAEA
QAMARELRDAARSGDTDGPVRLRETLRFGVAGRARIREPHTPSS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgtcgtcatcgtgggcgccggtgtgatcggccgctccgtcgggctcgccctg
cggcggcacggcgtgaccacgtacctgaccgacgccgaccccgaggcggcgctggcgggc
gaacgctgcggggccggcttcgcggcgccgccgccgcgacaggccgacatcgcggtgctc
gcggtgccgcccgaccaggtcgcgccggtgctcgccgagcaccagaagctcggcacggcc
cgctgctacaccgacgtctccggcgtcaaggtgcgtctgcaccgggaggtcagggcgcac
ggctgcgacctgacctccctggtcagcggcgcccccgtggtcggcggcagcggccccgtc
caggcccgcgccgacctcttcgacggcaggccctgggcgctcacgcccaccgaggccacc
gggaacctcgccctgaactgcgcgctggaactggtcgcgctgtgcggggcggtctcggtg
ctgctggaccccgagacccacgaccgcgccgtggccctcgtctcgcacgccccgcacctg
gtcgcgagcctggtcgccgcgcggctgctcggcggcgacgagtcggccgtacggctggcc
ggccaggacctgcgggacgtcaccaggaccgcggacgccaacccggaacgctgggcccgc
atcctgaccgccaacgccggtcccgtcgccgaccagttggacgactgggcggccgaggcg
caggcgatggcccgcgaactgagggacgccgcgcggtccggcgacaccgacggcccggtc
cggctgcgggagaccctgcgcttcggcgtggccggacgcgcccgcatccgggagccgcac
actccctcgtcctga

DBGET integrated database retrieval system