KEGG   Streptomyces coelicolor: SCO3231Help
Entry
SCO3231           CDS       T00085                                 

Gene name
cdaPS2, SCE63.02c
Definition
(RefSeq) CDA peptide synthetase II
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C RHH_5
Motif
Other DBs
NCBI-GeneID: 1098665
NCBI-ProteinID: NP_627444
Kitasato: SCO3231
UniProt: Q9Z4X5
Position
3565723..3576735
Genome map
AA seq 3670 aa AA seqDB search
MSQQPTRARGKIEDILPLSPLQEGFVFLGLLHTEGPDLYIGQVAFDLEGPFDGARMREAA
RALLRRHANLRAGFRQRKNGAWAQLVLRDVDLPWQDADLSTLSEEERRAEADRLAAADRA
RRFDLGRPPLLRFTAIRLSADRVRLVMTNHHIVLDGWSMPVLLRELMALYAAEGDPSALP
RVRPYRDYLAWLDARDRDAARDAWRRSLSGLDEATLLAPDAGPASTAPSQVSFTVDSEVS
GALSAWARGQGVTMNTVVQGAWALALAQATGRDDVVFGATVSGRPPELPGVESMIGLFIN
TLPVRARLDQAEPLGDLFRRLQNEQARLLDHQWPGLADIQHWAGHGELFDTAMVFQNYPV
EEGDLTAPADPDRLRVASADIKGGTHFAVNVVATMRGAELSFRVDYRPDLYDEAYARDFG
RRMLRVLETLISDPDRPVAHLDTLDPAVRERVLVEWNGAPTQLPGTPLHELISEQARLTP
DAVAVVCDGTSLTYAELDGRANQLARHLLERGLGAEDFVAIALHKSLDAVTSMLAVLKTG
AAYLPIDPDYPAERITYMLDDARPALTLREPVPAAAYGHRPTDDVTDAERRTPWSALHAA
YMIYTSGSTGRPKGVVIEHHALATYLHRARNTYTAMTGVTVLHSPLAFDLTITALWTPLT
AGGTVHLTSLEEAEVQPSLIKATPSHLPLLTNLAATASPSHTLILGGEALHTDQLTDWRT
QHPGAQIINAYGPTESTVNITDHRLDGTEEGPVPIGRPFANTQVYVLDSALRPVAPGTTG
ELYLAGEQLARGYLGRPALTAERFTANPHSSVPGARMYRTGDLAHWNHHGHLTYDGRADH
QIKLRGHRIEPGEIETTLTAQTGITQATVQLREDQPGDQRLVAYLVTSTGYDENTVRDAL
VSALPDYMVPSALVTLDALPLTPNGKLDRTALPAPAYSASTTGRTPRTPREEILCTLYSE
ILSVNTVGIDDSFFDLGGHSLLATRLVSRIRTTLGRELPIRQLFETPTVAGLSRALDTSG
TLRTALTARPRPERIPLSYAQQRLWFLHQLEGPTATYNIPTTLRLTGTLDTDALQSAFND
LLARHESLRTTYTEDDQGAQQIVLPVEAVATPFAVVDVAAEDVAERVAEAAAHAFDLGAE
IPVRARLFRVSEREHVLLLLVHHIASDAWSRGPLAQDLTAAYTARCADDAPAWQPLPVQY
ADYALWQQEILGDDTDPDTLAGRQLAYWKQQLAGLPEQLDLPTDRPRPATADHTGDRVTF
TVPADLHTRLTELARETNTTAFMVIQAALAALLTRHGAGEDIPIGTPVAGRTDDATDHLI
GFFVNTLVLRTDTSGNPTFRDLLTRVRDTDLTAYTHQDLPFERLVEALNPTRSLTHHPLF
QTMLTLHNTQGTKTDRFAGLAAEVVASESVSARFDLSFALAEHFGADHSCAGMSGGVTYS
TALFDRATVRDLADRLVRLLAAAVAHPGRSVGQLEIMDAAERRLVLQEWNDTAAEPPAAS
VTGLFERQARRSPGATALEFGEVRLSYAELNARANRLARHLVARGAAPGRFVAVALPRSA
ELVVTLLAVLKSGAAYLPIDPHYPADRVEYMLADAGPALTVTEPVAEAGLSGYGDADLGA
DELRGPVHGAHPAYTIYTSGSTGRPKGVVVPRGALDNFLADMGRRFTPGSGDRLLAVTTV
GFDIAGLEIFLPLLHGAVLVLADEETARDPHALLHRVSASGITMVQATPSLWQGVAAVAG
DELAGVRVLVGGEALPSELARALTDRARSVTNLYGPTEATIWATAADVAESGPVIGRPLA
NTSAYVLDSALRPVPVGVPGELYLAGEQLAQGYHLRPALTSERFTADPYGPAGTRMYRTG
DLVCRRRDGALRYLSRVDQQVKLRGFRIELGEIEAELSRHPAVAESAVTVREDRPGDRRL
VGYVVPKGPEGPAGPTGPVPSARELRERLRGRLPEFMVPTAFVVLDALPLTPNRKLDRKA
LPAPEYDGEPVGRGPRDPREEILCALFAEVLGVARVGIDDGFFDLGGHSLLATRLVSRIR
TALGVELSVRQFFETPTIAGLSGALDRAAGARAPLAARPRPERVPLSPAQQRLWFLHQFE
GPSATYNMPTALRLSGPVDRAALERAIGDVLVRHESLRTVFAADDGGSWQVVLPADRAVG
RLDVVDVTAGEVAERVGEAARHAFDLTADIPFLARLFRVSDTEHVLLLLIHHIAGDGWSM
APLARDLTAAYAARCAGAAPDWEPLPVQYADYALWQREVLGDESDPDSVAARQLAYWKDA
LAGLPEQLELPTDRPRPATAGYTGDRIAFTVPTALHARLTELARSTHSSLFMVVQAAFAT
LLTRLGAGEDIPVGTAVAGRNDAATEDLVGFFVNTLVLRTDTGGNPTFRELLGRVRERDL
AAYAHQDVPFERLVEALNPARSLAHHPLYQVMITFNNTAGAGDRTAPASPDTPDVSGQAG
ALLNATRMTAGTGVAKFDLALTFGERHDPSGGPAGMRGSLEYRTELFDRETAESVISRLL
GVLGSVTADPDRPIGGIGLLDPAERRQVLREWNDTARPQREGTLPRLFEEQVARTPRRPA
FSAAGTTLTYAELNSRANRLAHLLAESGAGPEQVVAISLPPSVEMGVAVLAVLKTGAAYL
PVDPGSPRERIATMAEDAAPVCALTTSAVPAGVFPAELPRLLLDDPDVTARLAAQPAHDL
TDEDRTQPLSPWNAAYIIYTSGSTGRPKGVLVEHQPVLNYLAVSAELYPGVAGNALLHSP
LSFDLTVTGLFAPLLNGGCVHLADLEELHARALDGEVPDLPQTTFLKATPSHLPLITGLP
GVCVPDGELVLGGESLTGRAVRTLLAAHPGARVLNEYGPTETIVGCTTWRVEAPDDLADG
VLTIGRPFPNTRMLVLDPYLQPVPAGVPGELYVSGVQLARGYLNRPGQSASRFVANPFEG
PGERMYRTGDIVRWNRRGDLEFISRVDDQVKIRGFRVELGEVESALSRQPGVPEAVAVVR
EDRPGDRRLVAYLVTGAGPVPVPSDEELRERLRETLPDYMVPSAFVRLPELPLTGNGKLD
RGRLPAPDYAAAGTGRAPVTAREELLCALFAEALGLESVGVDDGFFDLGGDSILSIQLVS
RARAKGLTLSVRDVFEHQSVARVAEALELAEAQAADGAAGASAGAVPGAAEEEAAASGPV
PATPIMGWFAALGGPVAPFNQSVVVSVPADLDAERLVAALGALLDRHDSLRLRVAADWSM
SVPEPEPGGTDAAGLLTRRAAGDVDDAGLHALLAEAGAAERDRLSPADGRMLRACHVDRG
PDRPGLLVLVAHHLAVDAVSWRLLVPDLAAAYEGRPLSPAGTGWRRWASALRDLAGSPVT
EAETDHWLDAARPAAEPADPVLDPARDTHARSGQVVLDLDPDTTDALLTWVPGVFRAEIN
DLLLTAFGLAVADWRRDRGARGTAPVTVDLESHGRHEHLVPGADLTRTTGWFTSMHPVPL
HPEVDDPDWAEVWDGGAAAGRALKRVKEQLRAVPRDGVGHGLLRHLNPRTRDRFAALPTP
AYGFNYLGRHTGGRGGGAPGGGAGPEPWSVLGRGVAGQHPDTPLAHPVELVAGAHDTDAG
PTLHSVWTYADAVLSETEVRRLGEGWFRALKALVEHAGRPEASGLTPSDVSLTSLSEDDI
SRLESEWGSL
NT seq 11013 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcaaccgacccgtgcgcgcggcaagatcgaggacatccttccgctctccccg
ctgcaagagggcttcgtgttcctcgggctgctgcacaccgaggggcccgacctctacatc
ggccaggtggccttcgacctggagggccccttcgacggcgcccggatgcgcgaggcggcc
cgggcgctgctgcgccggcacgccaacctgcgcgccgggttccggcagcgcaagaacggg
gcctgggcccaactggtcctgcgcgacgtcgacctgccgtggcaggacgccgacctgagc
acgctgtccgaggaggagcgccgggcggaggccgaccggctcgcggccgccgaccgtgcc
cgccgtttcgacctgggccggcccccgctgctgcgcttcaccgccatccggctgtccgcc
gaccgcgtccgcctggtgatgaccaaccaccacatcgtgctggacggctggtccatgccg
gtcctgctgcgcgaactcatggcgctctacgccgccgagggtgacccctccgcgctcccc
cgggtccgtccctaccgcgactacctggcctggctcgacgcccgcgaccgggacgccgcc
cgcgacgcctggcggcggtccctgtccgggctcgacgaggccaccctcctcgccccggac
gccggcccggcgtcgaccgctccctcgcaggtgtccttcaccgtggactccgaggtcagc
ggcgccctgtcggcctgggctcggggccagggcgtgaccatgaacacggtggtccagggt
gcctgggccctcgcgctggcccaggccaccggacgcgacgacgtcgtcttcggcgccacc
gtctccggccgcccgcccgagctgcccggcgtcgagtccatgatcggcctgttcatcaac
accctgcccgtccgcgcccgcctcgaccaggccgaacccctcggcgacctcttccgccgc
ctccagaacgaacaggcccgcctcctggaccaccagtggcccggactcgccgacatccag
cactgggccggacacggcgaactcttcgacaccgccatggtcttccagaactacccggtc
gaggagggcgacctcaccgcccccgccgacccggaccggctccgggtcgcctcggccgac
atcaagggcggcacgcacttcgccgtcaacgtcgtcgcgacgatgcgcggcgccgaactg
tccttccgcgtcgactaccgacccgacctctacgacgaggcgtacgcccgcgacttcggc
cgacggatgctacgggtactggaaaccctgatctccgacccggaccgtcccgtggcccac
ctggacaccctcgacccggccgtacgggagcgggtcctggtggagtggaacggggccccg
acccagcttcccggaacgccgctgcacgaactgatcagcgagcaggcccggttgactcca
gacgccgtggcagtggtgtgcgacggcacctccctgacctacgccgagctggacgggcgc
gccaaccagctcgcccggcacctgctcgaacgagggctcggagcagaggacttcgtcgcg
atcgcgctgcacaagtccctggacgccgtcaccagcatgctggccgtgctcaagaccggc
gcggcctacctgcccatcgacccggactaccccgccgaacgcatcacctacatgctcgac
gacgcccgaccggcgctcaccctcagggagcccgtaccggcggctgcatacggtcaccgg
cccaccgacgacgtcacggacgcggaacgacggacgccctggtcggcactccatgccgcg
tacatgatctacacctccggctcgaccggccgccccaagggcgtcgtcatcgaacaccac
gctctagccacctacctccaccgcgcccgcaacacctacaccgccatgaccggcgtgacc
gtcctgcactcacccctggccttcgacctcaccatcaccgccctgtggacgcctctcacc
gccggcggcacagtccacctgaccagcctggaggaggctgaggtccagcccagcctgatc
aaggccacacccagccacctccccctgctcaccaacctggcagccacggcatccccgtcc
cacaccctcatcctcggcggcgaagccctccacaccgaccagctgaccgactggcgcacc
cagcaccccggcgcccagatcatcaacgcctacggacccaccgaatccaccgtcaacatc
accgaccaccgcctcgacggcacggaagaaggccccgtccccatcggacggcccttcgcc
aacacccaggtctacgtcctcgactcagccctgcggcccgtcgcccccggcaccaccgga
gagctgtacctcgccggagaacaactcgcccgcggctacctcggccgccccgccctcacc
gccgaacgcttcaccgccaacccccacagcagcgttcccggcgcccgcatgtaccgcacc
ggcgacctcgcccactggaaccaccacggccacctcacctacgacggacgcgccgaccac
cagatcaaactccgcggccaccgcatcgaacccggcgagatcgaaaccaccctcaccgca
cagaccggcatcacccaagccaccgtccaactccgtgaggaccagccgggcgaccagcgc
ctcgtcgcctacctggtcacctccaccggatacgacgagaacaccgtgcgcgacgccctg
gtcagcgcactgcccgactacatggtccccagcgcactcgtcaccctcgacgccctcccc
ctcacccccaacggcaaactcgaccgcaccgccctccccgcccccgcctactcggcatcc
accaccggacgaaccccccgcaccccccgcgaggaaatcctctgcaccctgtactcggag
atcctctcggtgaacaccgtgggcatcgacgacagcttcttcgacctcggcgggcactcc
ctcctcgccacccgcctggtgagccgcatccgcaccaccctcgggcgggagctgccgatc
cggcagcttttcgagacgccgaccgtcgctggcctctcccgtgccctggacacgtccggc
accctgcgcaccgcgctcaccgcgaggccgcgccccgagcgcatcccgctctcctacgcc
cagcaacgcctctggttcctccaccaactcgaaggacccaccgccacctacaacatcccc
accaccctccgcctcaccggcaccctcgacaccgacgccctgcaatccgcgttcaacgac
ctcctcgcccgccacgaaagcctgcgcaccacctacaccgaggacgatcagggcgcccag
cagatcgtgttgcccgtggaggccgtcgcgacgccgttcgccgtcgtcgacgtggccgcg
gaggacgtggcggaacgggtggccgaggcggcggcgcacgccttcgatctgggcgcggag
atcccggtacgggcgcggctgttccgggtctcggagcgggagcacgtcctgctgctgctc
gtgcaccacatcgccagtgacgcctggtcccgcggcccactggcccaggacctcaccgcc
gcctacaccgcccgctgcgccgacgacgcacccgcctggcagcccctccccgtccagtac
gccgactacgccctgtggcagcaggagatcctcggcgacgacaccgaccccgacaccctc
gccggccgccagctcgcctactggaaacagcagctcgccggcctgcccgaacagctcgac
ctccccaccgaccggccccggcccgccaccgccgaccacaccggcgaccgcgtcaccttc
accgtccccgccgacctgcacacccgtctgaccgaactcgcccgggagaccaacaccacg
gcgttcatggtgatccaggcggcgttggcggcgttgctgacgcggcacggcgcgggcgag
gacatcccgatcggcacccccgtcgccggacgcaccgacgacgccaccgaccacctcatc
ggcttcttcgtcaacaccctcgtcctgcgcaccgacaccagcggcaaccccaccttccgc
gacctcctcacccgagtccgcgacaccgacctcaccgcctacacccaccaggacctcccc
ttcgaacgcctcgtagaagccctcaaccccacccgctccctcacccaccaccccctcttc
cagacgatgctcaccctgcacaacacgcagggcacgaagacggaccggttcgccgggctg
gctgcggaggtggtggcgtcggagtcggtgtcggcgcgcttcgacctgtcgttcgcgctg
gccgagcacttcggtgccgaccattcctgcgcgggcatgagcggcggcgtcacgtacagc
acggcgctcttcgaccgtgccacggtgcgggacctcgccgaccggctggtgcggttgctc
gcggcggcggtggcacacccggggcggtccgtggggcagttggaaatcatggacgcggcc
gaacggcggctggtccttcaggagtggaacgacaccgcggccgagccgccggccgcgtcg
gtgaccgggctcttcgagcggcaggcgcggcggtcgccgggggcgacggccctggagttc
ggcgaggtgcggctgtcctacgcggagctgaacgcgcgcgccaaccggctggcccggcat
ctcgtcgcgcggggcgcggcgccgggccggttcgtggccgtggcgctgccccgctcggcg
gagctggtcgtgacgctgctggcggtcctcaagtccggggccgcctacctgccgatcgac
ccgcactacccggccgaccgggtggagtacatgctggccgacgcggggcccgcgctcacg
gtgaccgaaccggtggcggaggccgggctgtcggggtacggggacgcggacctcggggcg
gacgagctgcggggcccggtccacggggcgcatccggcgtacacgatctacacctcgggt
tccacggggcggcccaagggcgtggtggtgccgcgcggggcgctggacaacttcctggcc
gacatgggccggcggttcacgccggggtccggtgaccggctgctcgccgtgaccacggtg
ggcttcgacatcgcgggcctggagatcttcctcccgctgctgcacggcgcggtgctggtg
ctcgccgacgaggagaccgcgcgcgacccgcacgcgctgctgcaccgggtgtcggcgtcg
gggatcaccatggtccaggcgacgccgagcctgtggcagggggtcgcggccgtggccggg
gacgagctggccggggtgcgggtgctggtgggcggggaggcgttgccgtccgagctggcg
cgggcgctgacggaccgcgcccgctccgtgacgaacctgtacgggccgacggaggcgacg
atctgggcgacggcggccgatgtcgccgagtccgggccggtcatcggccggccgctcgcc
aacacctcggcctacgtgctggactcggcgctgcggccggtcccggtcggtgtgccgggc
gagttgtatctggccggggagcagttggcgcagggttatcacctgcgtcccgcgctgacg
tcggagcggttcaccgccgacccgtacggcccggccggtacccggatgtaccgcacgggc
gacctggtgtgccggcgccgggacggtgcgctgcgctatctgagccgggtggaccagcag
gtcaagctgcggggtttccgtatcgagctcggggagatcgaggcggagctgtcccggcat
ccggcggtggccgagtccgcggtgacggtgcgcgaggaccggccgggcgaccggcggctg
gtcgggtacgtcgtaccgaagggtccggagggaccggcgggtccgacaggtccggtgccg
agcgcgcgggagttgcgggagcggctgcgcggacggctgccggagttcatggtgccgacg
gcgttcgtggtgctcgacgcgctgccgctgacgccgaacaggaagctggaccgcaaggcg
ctgcccgctccggagtacgacggcgagccggtgggccgggggccgcgggatccgcgcgag
gagatcctgtgcgcgctgttcgccgaggtgctgggcgtcgcccgggtcggcatcgacgac
ggcttcttcgacctgggcgggcactcgctgctcgccacccggctggtcagccgcatcagg
acggcgctgggcgtcgaactgtccgtgcgccagttcttcgagacgccgacgatcgccggg
ctctccggcgccctggaccgggcggcgggcgcgcgggcgccgctggcggcccggccgcgt
ccggagcgggtcccgctgtcgccggcgcagcagcgcctgtggttcctgcaccagttcgag
ggcccgtcggcgacgtacaacatgccgacggcgctccggctgtccggtccggtggaccgg
gcggcgctggagcgggcgatcggtgacgtgctggtccggcacgagagcctgcggaccgtg
ttcgcggcggacgacggggggtcgtggcaggtcgtgctgcccgccgaccgggccgtcggc
cgcctggacgtggtcgacgtgaccgccggggaggtggcggagcgggtcggcgaggcggcc
cggcacgccttcgacctgacggccgacatcccgttcctggcccggctgttccgcgtctcg
gacaccgagcacgtcctgctgctgctcatccaccacatcgcgggcgacggctggtcgatg
gccccgctggcccgtgatctcacggccgcgtacgcggcgcgctgcgcgggcgcggcaccg
gactgggagccgctgccggtgcagtacgccgactacgcgctgtggcagcgggaggtcctc
ggcgacgagtccgaccccgacagcgtggcggcgcggcagctggcctactggaaggacgcc
ctggcggggctgccggagcagttggagctgcccaccgaccggccccgcccggcgaccgcc
ggatacaccggcgaccgcatcgcgttcacggtgccgacggcgctgcacgcgcggctgacg
gagctggcgcggtccacgcactccagcctgttcatggtggtccaggcggcgttcgccaca
ctgctgacgcggctgggggcgggcgaggacattcccgtcggcacggcggtcgcggggcgc
aacgacgccgccaccgaggatctcgtcggcttcttcgtgaacacgctggtgctgcgcacc
gacaccggcggcaacccgaccttccgcgagctgctgggccgggtgcgcgagcgcgacctg
gccgcgtacgcgcaccaggacgtgccgttcgagcggctggtggaggcgctgaacccggcg
cgcagtctggcccaccacccgctgtaccaggtgatgatcaccttcaacaacacggccggt
gcgggcgaccgcaccgcgcccgcctccccggacaccccggacgtgtccgggcaggccgga
gcgctcctgaacgcgacccggatgacggccggtaccggggtggccaagttcgacctggcg
ctgaccttcggcgagcggcacgatccgtcgggcggtcccgcgggcatgcgcggttcgctg
gagtaccgcacggagctgttcgaccgggagaccgcggagtcggtgatctcgcggctgctc
ggggtgctgggctcggtcaccgccgacccggaccggccgatcggcgggatcggcctgctg
gacccggccgagcggcgccaggtgctgcgggagtggaacgacaccgcgcgcccgcagcgc
gaggggaccctgccccggctgttcgaggagcaggtcgccaggactccgcgccgcccggcg
ttctcggccgccgggacgacgctgacgtacgccgagctgaactcgcgtgccaaccggctc
gcccatctcctcgcggagtccggggcgggcccggagcaggtggtggcgatctcgttgccg
ccgtcggtggagatgggcgtggcggtgctcgcggtgctgaagacgggggccgcgtacctg
ccggtcgacccgggcagtccgcgcgagcggatcgccaccatggccgaggacgcggcgccg
gtgtgcgcgctgacgacgtccgcggtcccggccggggtgttcccggcggagctgccccgg
ctgctgctcgacgacccggacgtcaccgcccggctggcggcgcagcccgcgcacgacctg
acggacgaggaccgcacgcagccgctgtcgccgtggaacgcggcgtacatcatctacacg
tcgggctccacgggccgccccaagggggtgctcgtggagcaccagccggtgctgaactac
ctggcggtgtcggcggagctgtacccgggcgtggcgggcaacgcactgctgcactcgccg
ctctccttcgacctgacggtgacgggtctgttcgcgccgctgctgaacggcggctgcgtg
cacctcgcggacctggaggagctgcacgcgcgggcgctggacggcgaggtgcccgacctg
ccgcagacgacgttcctgaaggcgacgccgagccatctgccgctgatcaccgggctgccc
ggggtgtgcgtgccggacggggagctggtcctgggcggcgagtcgctgaccggccgcgcg
gtgcggacgctgctcgcggcgcatccgggggcgcgggtcctcaacgagtacggtccgacc
gagacgatcgtgggctgcacgacctggcgggtcgaggcgccggacgacctcgcggacggt
gtgctgaccatcggccgcccgttccccaacacgcgcatgctggtcctcgacccgtacttg
cagcccgtaccggccggggtgccgggcgagttgtacgtgtccggggtgcagctggcgcgc
ggctatctgaaccggcccgggcagagcgcgtcccggttcgtcgccaaccccttcgagggg
ccgggcgagcggatgtaccgcaccggcgacatcgtgcgctggaaccggcggggtgacctg
gagttcatcagccgggtcgacgaccaggtgaagatccgcggcttccgggtggagctgggc
gaggtcgagtcggccctgtcgcggcagccgggggtgccggaggcggtggccgtggtgcgc
gaggaccggccgggcgaccggcggctggtggcgtacctggtgaccggagccggaccggtg
ccggtgccctcggacgaggagctgcgggagcggctgcgcgagacgctgcccgactacatg
gtgccgtcggcgttcgtgcgcctgccggagctgccgctgaccggcaacggcaaactggac
cgggggcggctgcccgcaccggactacgcggccgccggcacgggccgggccccggtcacg
gcgcgcgaggagctgctgtgcgcgctgttcgccgaggcgctgggcctggagtcggtcggt
gtcgacgacggcttcttcgacctgggcggcgacagcatcctgtccatccagctggtcagc
cgggcccgcgcgaagggcctcacgctctccgtgcgggacgtcttcgagcaccagagcgtc
gcccgcgtcgccgaggcactcgaactcgccgaggcgcaggccgccgacggcgcggcgggg
gcgtcggcgggtgccgtaccgggagcggcggaagaggaggcagcggcgagcgggccggtg
cccgcgacgccgatcatggggtggttcgccgcgctgggcgggccggtcgcgccgttcaac
cagtcggtggtggtgtcggtgcccgcggacctggacgcggagcggctggtggccgccctc
ggggcgctcctggaccggcacgactcgctgcggctgcgggtcgccgcggactggtccatg
tccgtgcccgagcccgagcccggcggcacggacgccgccggtctcctcacgcgccgcgcg
gccggggacgtcgacgacgccgggctgcacgctctgctggccgaggcgggcgccgccgag
cgcgaccggctgtccccggccgacgggcggatgctgcgggcctgccacgtcgaccgtggg
ccggaccggccggggctgttggtcctggtcgcccaccacctggccgtggacgcggtcagc
tggcggctgctcgtgccggacctggccgccgcctacgagggccgcccgctcagcccggcg
ggcaccggctggcgccggtgggcgtcggcgctgcgggacctggccggctcccccgtcacc
gaggccgagacggaccactggctggacgcggcccgcccggccgccgagccggcggacccg
gtactggatccggcgcgcgacacccacgcccgctcggggcaggtcgtcctcgacctcgac
ccggacaccaccgacgccctgctcacctgggtgcccggggtgttccgggcggagatcaac
gacctgctgctcaccgcgttcgggctggccgtcgccgactggcggcgcgaccggggcgcc
cggggcacggcgcccgtcacggtggacctggagagccacggccgccacgagcacctggtg
ccgggcgccgacctcacccgcaccaccggctggttcacctcgatgcacccggtgccgctg
caccccgaggtcgacgacccggactgggccgaggtgtgggacggcggggcagcggccggg
cgggccctgaagcgggtcaaggagcaactgcgcgccgtcccgcgcgacggtgtgggccac
ggcctgctccgtcacctcaacccgcgcacccgggaccgtttcgccgccctgccgacaccg
gcgtacggcttcaactacctgggccgccacaccggcggccggggcggcggcgcaccgggc
ggcggcgccgggcccgagccgtggagcgtgctcgggcggggcgtggcggggcagcacccc
gacaccccgctggcgcacccggtggaactggtcgcgggcgcccacgacaccgacgcgggg
cccacgctgcacagcgtgtggacgtacgcggacgccgtgctgtccgagaccgaggtgcgg
cgcctgggcgagggctggttccgggccctgaaggcgctggtcgagcacgccggccggccc
gaggcgagcggtctgaccccctcggacgtctccctcacctcgctcagcgaggacgacatc
tcccgactcgagagcgaatggggttccctctga

DBGET integrated database retrieval system