KEGG   Streptomyces coelicolor: SCO3236Help
Entry
SCO3236           CDS       T00085                                 

Gene name
SCE29.05c
Definition
(RefSeq) oxygenase
  KO
K18058  L-asparagine oxygenase [EC:1.14.11.39]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO3236 (SCE29.05c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.39  L-asparagine hydroxylase
     SCO3236 (SCE29.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauD CsiD
Motif
Other DBs
NCBI-GeneID: 1098670
NCBI-ProteinID: NP_627448
Kitasato: SCO3236
UniProt: Q9Z4Z5
Structure
PDB: 

Position
complement(3587687..3588688)
Genome map
AA seq 333 aa AA seqDB search
MAANAAGPASRYDVTLDQSDAELVEEIAWKLATQATGRPDDAEWVEAARNAWHAWPATLR
RDLAGFRRDSGPDGAIVLRGLPVDSMGLPPTPRVNGSVQREASLGAAVLLMTACGLGDPG
AFLPEKNGALVQDVVPVPGMEEFQGNAGSTLLTFHNENAFHEHRPDFVMLLCLRADPTGR
AGLRTACVRRVLPLLSDSTVDALWAPEFRTAPPPSFQLSGPEEAPAPVLLGDRSDPDLRV
DLAATEPVTERAAEALRELQAHFDATAVTHRLLPGELAIVDNRVTVHGRTEFTPRYDGTD
RWLQRTFVLTDLRRSRAMRPADGYVLGAAPQPA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaatgccgcgggaccggcgtcgcgctacgacgtgacgctggatcagtcggat
gcggaactcgtcgaggagatcgcctggaaactcgccacgcaggcgaccgggcggcccgac
gacgccgaatgggtcgaggcggccaggaacgcctggcacgcctggccggcgaccctgcgc
cgggacctcgccggattccgccgggactcgggaccggacggcgcgatcgtgctgcgcggt
ctgcccgtcgactccatggggctgccgccgaccccgcgggtcaacggctccgtgcagcgc
gaggcctcgctgggcgccgccgtgctgctgatgaccgcctgcgggctcggcgaccccggc
gcgttcctgccggagaagaacggcgccctcgtacaggacgtcgtccccgtgccgggcatg
gaggagttccagggcaacgccggttcgaccctgctgacgttccacaacgagaacgccttc
cacgagcaccgccccgacttcgtgatgctgctgtgcctgcgcgccgaccccacgggccgg
gcgggcctgcgcaccgcgtgcgtgcggcgggtgctgccgctgctgtccgactccaccgtg
gacgccctgtgggcaccggagttccgcaccgcgccgccgccctccttccagctgagcggc
cccgaggaggcacccgcaccggtactcctcggcgaccgttcggaccccgacctgcgggtg
gacctggcggccaccgagccggtgaccgagcgggccgccgaggccctgcgcgaactccag
gcccacttcgacgccaccgccgtcacccaccgcctcctgcccggggagctggcgatcgtg
gacaaccgcgtcaccgtgcacggccgcaccgagttcaccccccgctacgacggcaccgac
cgctggctccagcgcaccttcgtgctcaccgacctgcgccgctcgcgcgcgatgcggccg
gccgacggctacgtgctcggagcggccccgcagcccgcctga

DBGET integrated database retrieval system