KEGG   Streptomyces coelicolor: SCO3243Help
Entry
SCO3243           CDS       T00085                                 

Gene name
SCE29.12c
Definition
(RefSeq) myo-inositol phosphate synthase
  KO
K01858  myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00521  Streptomycin biosynthesis
sco00562  Inositol phosphate metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SCO3243 (SCE29.12c)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO3243 (SCE29.12c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.4  inositol-3-phosphate synthase
     SCO3243 (SCE29.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_5 Inos-1-P_synth
Motif
Other DBs
NCBI-GeneID: 1098677
NCBI-ProteinID: NP_627455
Kitasato: SCO3243
UniProt: Q9Z4Y8
Position
complement(3594627..3595793)
Genome map
AA seq 388 aa AA seqDB search
MRTGIWLVGARGSVATTTVVGAAALRAGLVPATGCVSALEAFDGVPLPGFDELVFGGHDV
VGTGLVKRAEQLAEAGVVPRGLPGVLTAELDAADAEIRPAPPGTEEGGDGTPDQASAAGA
IVADLTGFRERLGLDRVVVVNVSSTQPPAVPHPAHASAAALREALARGERPLPVSSLYAY
AALRAGCAFVDFTPSTGARLPALDELAREQGLPYAGSDGKTGETLVKSVLAPMFARRALR
VRSWSGTNLLGGGDGATLADPERVVSKNASKGLVLEAELGHAVEGGVHIHHVPDLGEWKT
AWDHVTFEGFLGARMTLQFTWQGCDSSLAAPLVLDLARFMALAHRAGVAGPVPELGFFFK
DPVGSAEHDLAAQYASLAAWARSVGAPA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccggaatctggctggtgggtgcccgcggctcggtggccaccacgaccgtcgtc
ggcgccgccgcgctgcgcgccgggctggtgccggccaccggctgtgtgagcgcgctcgag
gccttcgacggcgtgccgctgcccggcttcgacgagctggtcttcggcggccacgacgtc
gtcggcaccggcctggtcaaacgggccgagcagctcgccgaggcgggcgtcgtgccccgc
ggcctgccgggtgtgctgaccgcggaactcgacgcggccgacgccgagatcaggcccgcg
ccgccgggcacggaggagggcggcgacggcaccccggaccaggcgtcggccgccggggcg
atcgtcgccgacctcaccggcttccgggagcgcctcggtctggaccgggtcgtcgtcgtg
aacgtctcctccacccagccgccggccgtgccgcacccggcgcacgcctcggcggcggcc
ctgcgcgaggcgctggcgcggggcgaacggccgctgcccgtcagctccctgtacgcctac
gcggcgctgcgggccggctgcgccttcgtcgacttcaccccgtcgacgggagcgcgcctg
cccgcgctggacgaactcgcccgggaacagggcctgccctacgccggcagcgacggcaag
accggcgagaccctggtcaagtcggtgctcgcgccgatgttcgcgcgccgggcgctgcgg
gtgcgctcctggtccggcaccaacctgctgggcggcggcgacggggccaccctcgccgac
ccggagcgggtggtcagcaagaacgcctccaagggcctggtgctggaggcggagctgggc
cacgccgtcgagggcggcgtgcacatccaccacgttcccgacctcggggagtggaagacc
gcctgggaccacgtgacgttcgaggggttcctcggggcccggatgacccttcagttcacg
tggcagggctgcgactcctcgctggccgcgccgctcgtgctggacctggcccggttcatg
gccctcgcgcaccgcgcaggcgtcgccgggccggtgccggagctgggcttcttcttcaag
gacccggtgggctccgccgagcacgacctggccgcgcagtacgcgagcctggccgcctgg
gcgcgctcggtgggggcgcccgcgtga

DBGET integrated database retrieval system