KEGG   Streptomyces coelicolor: SCO3245Help
Entry
SCO3245           CDS       T00085                                 

Gene name
SCE29.14c
Definition
(RefSeq) salicylate hydroxylase
  KO
K00480  salicylate hydroxylase [EC:1.14.13.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00621  Dioxin degradation
sco00624  Polycyclic aromatic hydrocarbon degradation
sco00626  Naphthalene degradation
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    SCO3245 (SCE29.14c)
   00626 Naphthalene degradation
    SCO3245 (SCE29.14c)
   00624 Polycyclic aromatic hydrocarbon degradation
    SCO3245 (SCE29.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.1  salicylate 1-monooxygenase
     SCO3245 (SCE29.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 NAD_binding_8 Pyr_redox_2 FAD_binding_2 Pyr_redox Trp_halogenase DAO Amino_oxidase FAD_oxidored Lycopene_cycl GIDA HI0933_like AlaDh_PNT_C NAD_Gly3P_dh_N Pyr_redox_3 3HCDH_N DUF3570
Motif
Other DBs
NCBI-GeneID: 1098679
NCBI-ProteinID: NP_627457
Kitasato: SCO3245
UniProt: Q9Z4Y6
Position
complement(3596708..3597970)
Genome map
AA seq 420 aa AA seqDB search
MPKLRIAVVGGGIGGLAAALALTRKGHEVRVYEQAPELREAGVGMHLGPNGSRLLERWGL
GERLRALGVRPAGMEVRDWSHGGTLVRQPMGEEWLAEFGAPYYTIHRADLHTMLAESLPS
GTVRAGHRLERFTETGGGVRLEFADGSTAGADVLIGADGAHSVVRRTLAGPDTAVFSGQS
AFRGVVARDQVPGLPGDTLLVWAGPDARMLVYPVRGGRFLTFVAVVPDPRWRLESWSAPG
DLDELAARFDGWNTDVKSLVAAVRESRRWALYDREPLARWSAGAVTLLGDAAHPMLPHHG
QGVSQAVEDAAVLAHCLDAPTGPDPSASVSAAAAASAPAAAAASAPAARRAIAAALDAYE
GVRRPHTTRVQLGSRGGGSQRLRPDEDGTESTGTMSSLVEDVSWIQRHDAEAGLPPLPPP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaagctgcggatcgcagtcgtcggcgggggcatcggcggactcgccgccgccctc
gccctgacccggaagggccacgaggtacgcgtctacgagcaggcgccggaactcagggaa
gcgggcgtgggcatgcacctgggccccaacggcagccgccttctggaacgctggggcctc
ggcgagcggctgcgcgccctcggtgtacggcccgcgggcatggaggtgcgggactggtcg
cacgggggcaccctggtgcggcagccgatgggcgaggaatggctcgccgagttcggggcg
ccgtactacacgatccaccgggccgacctgcacaccatgctcgccgagtcgctgccctcc
ggcacggtgcgggccgggcaccggctcgaacggttcaccgagaccgggggcggggtccgg
ctggagttcgccgacggctccaccgccggcgcggacgtcctgatcggcgcggacggggcg
cactccgtggtgcgccgcaccctcgccgggcccgacaccgccgtcttctccggccagagc
gccttccgcggcgtcgtcgcccgcgaccaggttcccggcctgcccggtgacacgctcctg
gtgtgggcgggaccggacgcccgcatgctggtctacccggtgcgcggcgggcggttcctc
accttcgtcgccgtcgtgcccgacccgcggtggcgcctggagtcctggagcgccccgggc
gacctggacgaactggccgcccgcttcgacggctggaacaccgacgtcaagtccctggtg
gccgcggtgcgggagtcccggcgctgggcgctgtacgaccgtgagccgctggcccgctgg
agcgcgggcgccgtcaccctgctcggcgacgcggcccacccgatgctgccccaccacggc
cagggcgtcagccaggccgtcgaggacgcggcggtcctcgcacactgcctggacgccccg
acgggcccggacccctcggcctccgtatccgccgcagccgccgcctccgctcccgccgca
gccgccgcttccgctcccgccgcccggcgggcgatcgcggccgcgctggacgcctacgag
ggtgtccgcaggccgcacaccacccgggtccaactcggctcgcggggcggcggctcccag
cggctgcggcccgacgaggacgggaccgagtccacgggcacgatgtcgtccctcgtcgag
gacgtgtcctggatccagcgccacgacgccgaggccggcctcccaccgctgccgccgccg
tag

DBGET integrated database retrieval system