KEGG   Streptomyces coelicolor: SCO3247Help
Entry
SCO3247           CDS       T00085                                 

Gene name
SCE29.16c
Definition
(RefSeq) acyl CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00071  Fatty acid degradation
sco00592  alpha-Linolenic acid metabolism
sco01040  Biosynthesis of unsaturated fatty acids
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01212  Fatty acid metabolism
Module
sco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO3247 (SCE29.16c)
   00592 alpha-Linolenic acid metabolism
    SCO3247 (SCE29.16c)
   01040 Biosynthesis of unsaturated fatty acids
    SCO3247 (SCE29.16c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     SCO3247 (SCE29.16c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 1098681
NCBI-ProteinID: NP_627459
Kitasato: SCO3247
UniProt: Q9Z4Y4
Position
complement(3599006..3600808)
Genome map
AA seq 600 aa AA seqDB search
MTQREEELARVLSGPEFATIRPDDLSVLDYSLLTLRRARLLNGAGFAANSLWLGRGDSAR
FPEFLRTMGWIGAYDLSLLNVLVSHQIAGDALLSHGGPEQLDAWAGEIDAMERMYCFAGS
ELLAGSDLKRVRTTAVYDPHGRSLVLNTPRPADSKVWTGNSLHTGDVAMVLARLEVGGRD
EGHHWLRVPLREAGAVLPGVRIGRAEPKGGVTANQTGVLTFTDHRLPLSALMNRWASIDE
DGTYRSPLPRHRRFEECLATFTHERLFPSVGAAYAQLLACTITTRFAAVKQTFGRPLIGH
EHYRMRLSAAVGRSLAARHAMTALAEVAVARSAEGAPARDQVLHALISCGKSGCTGDARQ
TLAETRELCGGLGYHDANQIAPLLHDYEIAVTFGGDNTVLGYQATRFALRHREDFDRVLD
EAVAGAGRLDAVRVLRAVCDVLLDRVERDGAGEASAQWSRAVHQTLAIGHWARQASTPLS
ERLLAQYAAVCVLEHALAALRAGILDQDALLGFEAARHEAAGAPLDADALLRELAVPEGL
ISAPIAHPDFAERHAAAAHAGTAAAHAGTVPSPGTGPSPGTGPAPGTVQAPGTVQAGVRP
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacgcgaagaagagctggcccgtgtcctctccgggcccgagttcgccaccatc
cgaccggacgacctgagcgtcctcgactacagcctgctgacgctgcgccgggcgcggctc
ctcaacggcgccggtttcgcggcgaactccctctggctgggccggggcgacagtgcccgc
ttcccggagttcctgcgcaccatgggctggatcggcgcgtacgacctgtccctgctcaac
gtcctggtctcgcaccagatcgcgggcgacgcgctgctcagccacggcggtccggagcaa
ctggacgcctgggctggggagatcgacgcgatggagcggatgtactgcttcgccggttcc
gaactcctcgccggctcggacctgaagcgggtgcggaccaccgcggtctacgacccgcac
gggcggagcctggtgctgaacacgccccggcccgccgacagcaaggtgtggaccggcaac
agcctgcacaccggcgacgtggccatggtgctggcccggctggaggtcggcgggcgcgac
gagggacaccactggctgcgggtaccgctgcgcgaggccggggccgtactgcccggcgtg
cgcatcggccgggccgagccgaagggcggtgtcacggccaaccagaccggcgtactgacc
ttcacggaccaccggctgccgctgtccgcgctgatgaaccgctgggcgtcgatcgacgag
gacggcacctaccggtccccgctgccgcgccaccggcggttcgaggagtgcctggccacc
ttcacccacgagcggcttttcccgtcggtgggagcggcgtacgcgcaactgctcgcctgc
acgatcaccacgcggttcgcggccgtcaagcagaccttcggcaggccgctgatcggccac
gagcactaccgcatgcggctgtcggcggccgtggggcgctcgctggccgcccggcacgcc
atgacggcgctggccgaggtggcggtggcccggagcgccgagggagcaccggcccgcgac
caggtgctgcacgccctgatctcgtgcggcaagtccggctgcaccggcgacgcccggcaa
acgctggccgagacccgggagctgtgcggcgggctcggctaccacgacgccaaccagatc
gcgccgctgctgcacgactacgagatcgcggtcaccttcggcggtgacaacaccgtcctc
ggctaccaggcgacccggttcgccctgcgccaccgcgaggacttcgaccgggtgctggac
gaggcggtcgccggggccggacggctggacgccgtccgggtgctgcgggccgtctgcgac
gtcctgctcgaccgggtggagcgggacggcgccggtgaggccagcgcgcagtggagccgt
gccgtccaccagacgctggcgatcggccactgggcccggcaggcatcgaccccgctgtcc
gagcggctgctcgcgcagtacgcggcggtctgcgtgctggaacacgcgctggccgccctg
cgggccgggatcctcgaccaggacgccctcctggggttcgaggcggcccggcacgaggcg
gcgggcgcccccctcgacgccgacgcgctgctgcgcgaactggccgtgcccgagggcctg
atcagcgccccgatcgcccacccggacttcgcggaacggcacgccgccgcggcccatgcc
ggcaccgccgcggcccatgccggcaccgtcccgagcccgggtaccggaccgagcccgggt
accggaccggccccgggcaccgtgcaggcccccggcaccgtgcaggccggagtacgcccg
tga

DBGET integrated database retrieval system