KEGG   Streptomyces coelicolor: SCO3381Help
Entry
SCO3381           CDS       T00085                                 

Gene name
nadC, SCE94.32c
Definition
(RefSeq) nicotinate-nucleotide pyrophosphorylase
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
sco  Streptomyces coelicolor
Pathway
sco00760  Nicotinate and nicotinamide metabolism
sco01100  Metabolic pathways
Module
sco_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO3381 (nadC)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     SCO3381 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QRPTase_C QRPTase_N LysR_substrate Biotin_lipoyl Biotin_lipoyl_2 DUF1805 DUF2118
Motif
Other DBs
NCBI-GeneID: 1098818
NCBI-ProteinID: NP_627589
Kitasato: SCO3381
UniProt: Q9X8N7
Position
complement(3743829..3744818)
Genome map
AA seq 329 aa AA seqDB search
MNPSDPTELPLASGGGCGDGCACGAETEEEAFMECGLDPALAALLLDSGLDPVEVEDIAN
VAIQEDLAGGVDVTTVATIPEDAVATADFTAREAGVVAGLRVAEAVLSVVCTDEFEVERH
VEDGDRVAEGQKLLSVTTRTRDILTAERSALNLLCRMSGIASATRAWADALDGTKAKVRD
TRKTTPGLRGLEKFAVRCGGGVNHRMSLSDAALVKDNHVVAAGGVAEAFNAVRESFPEVP
IEVEVDTLHQLREVVDAGADLILLDNFTPDECEEAVALVAGRAALEASGRLTLTNAKAYA
ATGVDYLAVGALTHSSPILDIGLDLRAAE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccctccgaccccaccgaactccccctcgcctccggcggaggctgcggcgacggc
tgcgcctgcggcgcggagaccgaagaagaagcgttcatggagtgcggcctcgacccggcc
ctcgcggcactcctgctggactccggcctcgaccccgtcgaggtcgaggacatcgcgaac
gtcgccatccaggaggacctggccggcggcgtggacgtgacgacggtggcgaccatcccc
gaggacgccgtggccacggccgacttcaccgcccgcgaggcgggcgtcgtggcgggcctc
agggtcgccgaggcggtgctgtcggtcgtctgcaccgacgagttcgaggtggagcgccac
gtcgaggacggcgatcgcgtggcggagggccagaagctcctgtccgtcaccacccgcacc
cgcgacatcctgaccgccgaacgcagcgcgctgaacctcctgtgccgcatgtcgggcatc
gcgtcggccacgcgcgcgtgggcggacgccctggacggcacgaaggccaaggtccgcgac
acccgcaagacgacgccgggcctgcgcggcctggagaagttcgcggtccgctgcggcggc
ggcgtcaaccaccgcatgtccctctcggacgcggccctggtcaaggacaaccacgtggtc
gccgcgggcggcgtcgccgaggccttcaacgccgtgcgcgagagcttccccgaggtgccc
atcgaggtcgaggtcgacaccctgcaccagctgcgcgaggtggtggacgcgggcgccgac
ctgatcctcctggacaacttcaccccggacgagtgcgaggaagcggtcgccctggtcgcc
ggccgggccgccctggaggcctcgggccgcctgaccctcaccaacgccaaggcgtacgcg
gccacgggcgtcgactacctggccgtgggcgccctcacccacagctccccgatcctggac
atcggcctggacctgcgagcggcggagtag

DBGET integrated database retrieval system