KEGG   Streptomyces coelicolor: SCO3383Help
Entry
SCO3383           CDS       T00085                                 

Gene name
panC
Definition
(RefSeq) pantoate--beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00410  beta-Alanine metabolism
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO3383 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO3383 (panC)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     SCO3383 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase FAD_syn
Motif
Other DBs
NCBI-GeneID: 1098820
NCBI-ProteinID: NP_733602
Kitasato: SCO3383
UniProt: Q9X844
Position
complement(3746563..3747576)
Genome map
AA seq 337 aa AA seqDB search
MTTPTPPVLLRTAGELHARVRRGRRAVVMTMGALHEGHATLIRTARDIAGPDGEVVVTVF
VNPLQFGAGEDLDRYPRTLDADLEIAGRAGADAVFAPAVDEVYPGGEPQVRVTAGPMGGR
LEGASRPGHFDGMLTVVAKLLHLTRPDLALYGQKDAQQLALIRRMVRDLNFGVEIVGVPT
VREEDGLALSSRNRYLSTAERRTALALSQALFAGLDRHAAQEALCARAREVPATQARAEA
LSALGESRAAADAHAVATSAPGSATAVRDAARLVLDDAARATPPLELDYLALVDPSDFTE
IGDDHTGEAVLAVAARVGATRLIDNVHLTFGPLGAAS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccccacccctcccgtcctcctgcgcaccgccggcgagctgcacgcgcgtgtg
cggcgcggtcgccgcgccgtggtgatgaccatgggcgccctgcacgagggccacgccacc
ctgatccgcacggcgcgcgacatcgccggaccggacggcgaggtcgtcgtcacggtcttc
gtgaacccgctccagttcggcgccggcgaggacctcgaccgctatccgcgcaccctggac
gccgacctggagatcgccggacgggcgggcgccgacgccgtcttcgcccccgccgtcgac
gaggtctacccgggcggcgaaccccaggtgcgcgtcaccgcgggccccatgggcggacgt
ctggagggcgcctcacgccccggccacttcgacggcatgctcaccgtcgtcgccaagctg
ctccacctcacccgccccgacctcgccctctacggccagaaggacgcccagcagctcgcg
ctgatccgccgcatggtccgcgacctgaacttcggcgtggagatcgtcggcgtccccacc
gtgcgcgaggaggacggcctcgccctgtccagccgcaaccgctacctctcgacggcggaa
cgccgcaccgccctcgcgctctcgcaggccctcttcgcggggctggaccggcacgccgcg
caggaggcactgtgcgcgagggcccgcgaggtgcccgccacccaggcccgcgccgaggcg
ctcagcgccctgggcgagtcccgcgcggcggccgacgcccacgccgtcgccacctccgcc
cccggcagcgccacggccgtccgggacgccgcccgcctggtgctggacgacgccgcccgc
gccaccccgcccctggagctggactacctcgccctggtcgacccgtccgacttcaccgag
atcggcgacgaccacaccggcgaggccgtcctcgccgtcgccgcccgggtcggcgcgacc
cgcctgatcgacaacgtccacctcaccttcggacccctcggagccgcctcgtga

DBGET integrated database retrieval system