KEGG   Streptomyces coelicolor: SCO3400Help
Entry
SCO3400           CDS       T00085                                 

Gene name
folB, SCE9.07
Definition
(RefSeq) dihydroneopterin aldolase
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
sco  Streptomyces coelicolor
Pathway
sco00790  Folate biosynthesis
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCO3400 (folB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     SCO3400 (folB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     SCO3400 (folB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     SCO3400 (folB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FolB DUF2437 Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-GeneID: 1098837
NCBI-ProteinID: NP_627606
Kitasato: SCO3400
UniProt: Q9X8I0
Position
3765814..3766173
Genome map
AA seq 119 aa AA seqDB search
MDRVALRGLKARGHHGVFPKEREDGQTFLVDIVLGLDTRPAAADDDLAKTVHYGIVAEEV
VAVVEGEPVNLVETLAERIAQVCLKHEGVEEVEVCVHKPDAPITVPFDDVTVTIIRSRV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgtgtcgcgctgcgcggcctgaaggcccgcgggcaccacggtgtgttccccaag
gagcgcgaggacggccagaccttcctcgtggacatcgtccttggcctggacacccgcccg
gccgcggccgacgacgacctggcgaagacagtgcactacggcatcgtggccgaggaggtc
gtggccgtcgtcgagggcgagccggtcaacctcgtcgagaccctcgccgagcgcatcgcc
caggtctgtctgaagcacgaaggggtcgaggaggtcgaggtctgcgtccacaagccggac
gcgccgatcaccgtccccttcgacgacgtgaccgtcaccatcatccggagccgtgtatga

DBGET integrated database retrieval system