KEGG   Streptomyces coelicolor: SCO3409Help
Entry
SCO3409           CDS       T00085                                 

Gene name
ppa, SCE9.16
Definition
(RefSeq) inorganic pyrophosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCO3409 (ppa)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     SCO3409 (ppa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyrophosphatase
Motif
Other DBs
NCBI-GeneID: 1098846
NCBI-ProteinID: NP_627615
Kitasato: SCO3409
UniProt: Q9X8I9
Position
3775145..3775636
Genome map
AA seq 163 aa AA seqDB search
MEFDVTIEIPKGSRNKYEVDHETGRIRLDRRLFTSTAYPTDYGFVENTLGEDGDPLDALV
ILDEPTFPGCLIRCRAIGMFRMTDEAGGDDKLLCVPSTDPRVEHLRDIHHVSEFDRLEIQ
HFFEVYKDLEPGKSVEGADWVGRTEAEAEIERSYKRFKDQGGH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtggagttcgacgtcacgatcgagatcccgaagggttcgcggaacaagtacgaggtggac
cacgagaccggtcgtatccgcctggaccgccgcctgttcacctcgaccgcctacccgacc
gactacggcttcgtcgagaacaccctcggcgaggacggcgacccgctggacgcgctggtc
atcctggacgagccgaccttcccgggctgcctcatccgctgccgcgcgatcggcatgttc
cggatgacggacgaggccggcggcgacgacaagctgctgtgcgtgccgtcgaccgacccg
cgcgtggagcacctgcgtgacatccaccacgtgtcggagttcgaccgcctggagatccag
cacttcttcgaggtctacaaggacctggagcccggcaagtccgtcgagggcgccgactgg
gtgggccgcaccgaggccgaggccgagatcgagcggtcctacaagcgcttcaaggaccag
ggcggccactga

DBGET integrated database retrieval system