KEGG   Streptomyces coelicolor: SCO3420Help
Entry
SCO3420           CDS       T00085                                 

Gene name
SCE9.27c
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00053  Ascorbate and aldarate metabolism
sco00071  Fatty acid degradation
sco00280  Valine, leucine and isoleucine degradation
sco00310  Lysine degradation
sco00330  Arginine and proline metabolism
sco00340  Histidine metabolism
sco00380  Tryptophan metabolism
sco00410  beta-Alanine metabolism
sco00561  Glycerolipid metabolism
sco00620  Pyruvate metabolism
sco00625  Chloroalkane and chloroalkene degradation
sco00903  Limonene and pinene degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3420 (SCE9.27c)
   00053 Ascorbate and aldarate metabolism
    SCO3420 (SCE9.27c)
   00620 Pyruvate metabolism
    SCO3420 (SCE9.27c)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO3420 (SCE9.27c)
   00561 Glycerolipid metabolism
    SCO3420 (SCE9.27c)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO3420 (SCE9.27c)
   00310 Lysine degradation
    SCO3420 (SCE9.27c)
   00330 Arginine and proline metabolism
    SCO3420 (SCE9.27c)
   00340 Histidine metabolism
    SCO3420 (SCE9.27c)
   00380 Tryptophan metabolism
    SCO3420 (SCE9.27c)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO3420 (SCE9.27c)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO3420 (SCE9.27c)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO3420 (SCE9.27c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCO3420 (SCE9.27c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Tox-ODYAM1
Motif
Other DBs
NCBI-GeneID: 1098857
NCBI-ProteinID: NP_627626
Kitasato: SCO3420
UniProt: Q9X8J9
Position
complement(3785441..3786901)
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIDGEWRPGTGSWDIIDFNPYDNEKLASITIATVDEVDAAYRAAERAQR
QWAATNPYARRAVFEKALRLVEEREAEIGEAIVAELGGTRLKAAFELHLAKEFLREAVHL
ALAPEGRIIPSPVDGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPH
QNTPIVGGTLVAKILEDAGLPGGLLNVVVTDIAEIGDAFIEHPVPKVISFTGSDKVGRHV
ATVCAANFKRSVLELGGNSALVVLDDADVDYAVDAAVFSRFVHQGQVCMAANRVLVDRAV
ADEFTEKFVAKVSGLKVGDPRDPSTVIGPVINSSQADALSGVVEQALAEGATALVRGSVT
DNLVEPSVLTGLPADSALLRQEVFGPVAFLVPFDGEEEAVRLVNDTPYGLSGAVHTGDVE
RGVNFAKRIDTGMFHVNDGTVHDEPIVPFGGEKHSGLGRLNGDTMLDAFTTQKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtacttcaccgacctcgcccagcagtacatcgacggtgagtggcgtcccggc
accggctcctgggacatcatcgacttcaacccgtacgacaacgagaagctcgcctcgatc
acgatagccaccgtcgacgaggtcgatgccgcctaccgggccgccgagcgggcgcagcgg
cagtgggccgcgacgaacccctacgcgcgccgcgcggtgttcgagaaggcgctgcgcctg
gtggaggagcgcgaggcggagatcggcgaggcgatcgtcgccgagttgggcggcacccgc
ctgaaggccgccttcgaactgcacctcgccaaggagttcctgcgcgaggcggtccacctg
gcactcgcgcccgagggccggatcatcccctcgcccgtcgacggcaaggagaaccgcgtc
taccgggtgccggtcggcgtcgtgggcgtcatcagccccttcaacttccccttcctgctc
tccctgaagtcggtcgccccggccctcgccctgggcaacgccgtcgtcctcaagccgcac
cagaacaccccgatcgtgggcggcacgctggtcgcgaagatcctggaggacgccgggctg
ccgggcggcctgctcaacgtggtggtcaccgacatcgcggagatcggcgacgcgttcatc
gagcacccggtccccaaggtgatctccttcaccggctccgacaaggtcggccgccacgtg
gccacggtctgcgccgcgaacttcaagcgctcggtcctcgaactgggcggcaacagcgcg
ctggtggtgctcgacgacgccgacgtcgactacgcggtcgacgccgcggtcttcagccgc
ttcgtccaccagggccaggtctgcatggccgccaaccgcgtgctggtcgaccgcgcggtg
gcggacgagttcaccgagaagttcgtcgccaaggtgtcgggcctcaaggtcggcgacccg
cgcgacccgtcgaccgtcatcggcccggtgatcaactcctcgcaggccgacgcgctctcc
ggcgtggtcgagcaggcgctcgccgagggcgccaccgccctggtgcgcggctcggtcacc
gacaacctcgtcgagccgtcggtcctgaccggcctgcccgccgactcggcgctgctccgg
caggaggtcttcggcccggtcgccttcctcgtccccttcgacggggaggaggaggccgtg
cgcctcgtcaacgacacgccgtacgggctgagcggcgccgtgcacaccggggacgtcgag
cgcggcgtcaacttcgccaagcggatcgacaccggcatgttccatgtgaacgacgggacc
gtgcacgacgagccgatcgtgcccttcggcggcgagaagcactccggcctcggccgcctc
aacggcgacaccatgctggacgccttcaccacgcagaagtggatctccgtgcagcacgga
cggagcggcttccccttctag

DBGET integrated database retrieval system