KEGG   Streptomyces coelicolor: SCO3479Help
Entry
SCO3479           CDS       T00085                                 

Gene name
SCE65.15c
Definition
(RefSeq) beta-galatosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00511  Other glycan degradation
sco00600  Sphingolipid metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCO3479 (SCE65.15c)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SCO3479 (SCE65.15c)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCO3479 (SCE65.15c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCO3479 (SCE65.15c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 1098916
NCBI-ProteinID: NP_627682
Kitasato: SCO3479
UniProt: Q9RKF8
Position
complement(3840395..3843382)
Genome map
AA seq 995 aa AA seqDB search
MLPIIGALRPWADPTMTSLLRLPMRARPAAEGDRRLSLDGTWSFRLFPSPDQVPADAVRG
ERAPGQWQSVDVPGSWPVQVADDIPHYTNIQMPFAEPPPRLPSRNPTGVYRTGFDVPSHW
EGQRLLLHVGGADSVHAVYLNGVFVGYGTDARLGSEYDVTEAARVGRNQLAVVVVRYSAH
SFLEDQDGWWLAGLHRGVRVEARPPVGLVDLDARADLDPRSGEGSLDVRATVDFGESTAA
EGYRVRVSLSGRDGAGVAGPQDAPVPHAVNNTYEFSGHIARLHRDGLRILPWSAETPTLY
EVAAELIDPAGDVVDATRVRVGFRRVEIDGPDFLVNGRRVWIFGVNRHDHHPDTGAAVTA
EDMRADLAAMRRMNINAIRTSHYPNDPAFYDLCDELGFYVVDEANIESHAFNWYLCGDPR
YRATWLERGARMVARDRNHPCVVQWSLGNESGYGVNHDALAGWIRRADRSRPLHYEDAIR
NSGWTDGGRHATDVVCPMYPGIEEIRAYGEQVAAGAADRPLIMCEYSHAMGNSNGSLADY
WDVITSTPGLQGGFIWEWKDHGLRQRLPDGTTRLAYGGQFGDAPHDANFVADGLVSADVE
PHPGTAEVAWVYRPVTTEYVDGGLYVTNRRRFAGTGDLAAGWELLLDGAPSASGTLDVPD
IAPGGSVAVPLPADAARAGAAQALLTITWRTRTESWFAPAGHPVAWDQLALRDGRTAPGP
PVNGAVAVPGETADDPVPNVWRAATDNDGLKLMEHIVRVREMGSRTLIRWRDAGLDTRPA
HEIVDHTVSVSRSESGADYRHRFEVPDEAADLPRVGVLFRVDPRFDRFVWFGRGPHENYP
DRNRSAMLGRWSSHVEPSPYLVPQEFGLRTGTLWLELIDDDRGDRLRLTSLGGDFCWSAT
RYAPQALFAAGNASDLREDGRLVVCLDAAHRGVGTGACGPDVLPEYRIGPGRYELAYRME
LVPAVQGVAGAPPHPQDSSRAASGGGSQCKDRHVG
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
gtgctccccatcatcggtgctctccgcccgtgggcggaccctacgatgacatccctgctc
cgactcccgatgcgcgcgcgtcccgccgccgagggggaccgccggctgtcgctggacggc
acctggtccttccggctgttcccctctcccgaccaggtgcctgccgatgccgtgagagga
gagcgggcgcccgggcaatggcaatcggtcgacgtgcccggtagctggccggtccaggtg
gccgacgacattccgcactacacgaacatccagatgccgttcgccgagcctccgccgcgg
ctcccgtcgcgcaaccccacaggtgtgtaccgcacgggcttcgacgtcccgtcccactgg
gagggccaacggctgctgctgcacgtgggtggcgctgacagtgtgcatgccgtctacctc
aacggcgtgttcgtcggatacggcaccgacgcccgtctcgggagcgagtacgacgtgacc
gaagcggcccgcgtggggaggaaccagcttgccgtggtcgtcgtgaggtactcggcgcac
agcttcctcgaggaccaggacggatggtggctcgccggtctccaccgcggtgtgcgtgtc
gaggcccgcccgcctgtcggactcgtcgacctggatgcccgggcggacctcgatccccgc
tctggtgaaggatcgctcgatgtccgcgccacggtcgacttcggcgagagcacggcggcg
gagggatatcgcgtccgggtttcgctgtcgggccgcgacggtgcgggagtggcggggcct
caggacgctccggttccccatgcggtcaacaacacctacgagttctccgggcacatcgcc
cggctgcaccgggacgggcttcggatcctcccctggtcggcggagacgccgacgctctac
gaagtcgcagcggagctcatcgacccggccggagacgtggtcgacgcgacccgggtacgc
gtgggtttccgacgcgtcgagatcgacgggccggacttcctcgtgaacggccgacgtgta
tggatcttcggggtcaaccggcacgaccaccaccccgacaccggtgccgcggtcaccgcg
gaggacatgcgtgccgacctggcggccatgcgccggatgaacatcaatgccatccgcaca
tcccactatccgaacgatcccgccttctacgacctctgcgacgaactgggcttctacgtc
gtcgacgaggccaacatcgagtcgcacgcgttcaactggtacctctgcggcgacccgcgg
taccgcgcgacctggctggagcgcggggcccgcatggtggcgcgtgaccgcaaccatccc
tgcgtggtccagtggagtctgggcaacgagagcgggtacggcgtcaaccacgacgctctc
gcggggtggatccgccgcgccgaccgctcgcgtccgctccactacgaggacgccatccgg
aactccgggtggaccgacgggggccgtcacgccacggacgtcgtctgcccgatgtatccc
ggcatcgaggagatccgggcctacggggagcaggtggccgccggggcggcggaccgcccc
ttgatcatgtgcgagtactcgcacgccatgggtaacagcaacggctcactggccgactac
tgggacgtcatcacctccacgcccggactccagggcggcttcatctgggagtggaaggac
cacggcctgcgacagcggctccccgacggaaccacccgcctcgcgtacggtgggcagttc
ggcgacgcgccccacgacgcgaacttcgtcgcggacggcctggtttccgccgatgtcgag
cctcaccccggaacggccgaagtcgcctgggtgtaccggcctgtgaccactgagtacgtg
gacggcgggttgtacgtgaccaaccgacgtcgtttcgccggcacgggagacctcgcggca
ggctgggaactccttctggacggcgctccgtcggcctccggcacgctcgacgtccccgac
atcgcgcccggtgggagcgtggccgtgccgctgcccgcggacgcggcgcgcgcgggcgcc
gcgcaagccctgctgaccattacgtggcggacccgaacagagtcgtggttcgcaccggcg
gggcatcccgtcgcgtgggaccagctcgctctgcgggacggaagaaccgcccccggcccg
ccggtgaacggggctgtcgcggtgccgggcgagacggcggacgacccggtgcccaacgtg
tggcgcgctgcgacggacaacgatgggctcaagctgatggagcacatcgtccgtgtgaga
gagatgggatcacgcacccttatccgctggagggacgccggtctggacacgcggcccgcg
cacgagatcgtggaccacaccgtctccgtgtccaggagcgagagcggtgcggattaccgt
caccggttcgaggtgcccgacgaggcggcggacctgccgcgtgtcggcgtgctgttccga
gtggacccccgattcgaccggttcgtctggttcgggcggggcccgcacgagaactacccg
gaccggaaccggtcggcgatgttgggccgctggtcgtcgcatgtggaaccctctccctac
ctcgtgccgcaggaattcgggctgcgcaccgggacactctggcttgagctgatcgacgac
gatcgcggcgaccgccttcggctgacctcgctcggtggtgacttctgctggtcggcgacg
cggtatgcgcctcaggcgctgttcgccgccgggaacgccagtgatctgcgcgaggacggc
cgactggtcgtgtgcctggatgcggcgcacaggggggtcgggaccggggcatgcgggccc
gacgtcctcccggagtaccggatcggaccgggacgatacgagctggcctaccggatggaa
ctggtccccgcggtgcagggggtggcgggggcgccgccgcacccccaggactcatcgcgt
gccgcatcgggtggcggtagtcagtgcaaggaccgtcatgtagggtga

DBGET integrated database retrieval system