KEGG   Streptomyces coelicolor: SCO3486Help
Entry
SCO3486           CDS       T00085                                 

Gene name
SCE65.22
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
sco  Streptomyces coelicolor
Pathway
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO3486 (SCE65.22)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO3486 (SCE65.22)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     SCO3486 (SCE65.22)
    1.2.1.22  lactaldehyde dehydrogenase
     SCO3486 (SCE65.22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 1098923
NCBI-ProteinID: NP_627689
Kitasato: SCO3486
UniProt: Q9RKF1
Position
3850388..3851866
Genome map
AA seq 492 aa AA seqDB search
MTHELFDSKGLLGSAPAAFVAGEYELDSSHGTLPVINPANGQLVAEVPSSSSSTVDRAVT
AAVAAQREWGRRSHVARAAVLEAVRDAIAVHADELARIVSVEQGKPLSDARGETEGACAF
FDFAISQKYRAVGSMMASEPGRSLGVREEPIGVVAAILPWNFPVAIFARKVAPALMAGNA
VVLKPSELTPLSALALARLCRLAGVPDGLLSVVCGEGKDTGRALVTHPGVGMVTMTGSTR
GGREILAQVADQIIPVSLELGGKAPFIVFEDADLDAAVEAAADARLWNTGQVCTCNEVTY
VHADLHDEFVRRVVDRFASVTPLDPFAAGSRLGPLVAERERTRVQGMVDAAVAAGARVRT
GGGRPDGEQYQSGAWFAPTVLTNVRPEMDIARREVFGPVLPIIPFDAEAEVVSAANSTAY
GLTAYVYTRDLSRAMRMIDALEFGEVYVNQAGPEQVQGFHTGWKSSGLGGDDGPHGYEKY
LRRKTVYVRHAV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgactcacgaactcttcgacagcaaagggctgctgggcagcgcaccggcggccttcgtc
gccggtgaatacgagctcgactcctcgcacggcacgctcccggtgatcaatcccgccaac
gggcaactcgtcgccgaggtgcccagcagctcttcctcgacggtggaccgggccgtgacg
gcggcggtggccgcgcagcgcgagtgggggcgccgcagtcacgtcgcgcgcgcggccgtg
ctggaggctgtgcgcgacgcgatcgcggtgcacgccgatgagctggcgcggatcgtctcg
gtggagcagggcaagcctctctccgacgcccgtggcgagacggagggcgcgtgcgccttc
ttcgacttcgcgatcagccagaagtaccgggccgtgggctccatgatggcgagtgagccg
ggccggtcgctcggcgtgcgtgaggaacctattggcgtggtggcggcgatccttccctgg
aacttcccggtcgccatcttcgcccgcaaggtcgctcccgcgctcatggccggcaacgcc
gtcgttctgaagccgtcggagctcactcccctctccgcgctcgctctggcccggctctgc
cggctggccggggtgcctgacgggctgctgagcgtcgtgtgcggagagggcaaggacacc
ggacgggccctcgtcacccatccaggcgtcgggatggtcaccatgacgggctcgacacgc
ggcggccgggagattctggcccaggtggccgaccagatcatccccgtctccctcgagctc
ggcgggaaggctccgttcatcgtcttcgaggacgcggacctggacgccgcggtcgaggcc
gctgccgacgcacggctctggaacacgggacaggtctgtacgtgcaacgaggtgacctat
gtgcacgccgatctgcacgacgagttcgtgcgccgtgtggtcgaccggttcgcctcggtg
accccgctcgatccgttcgcggccggctcgcgactgggcccgctcgtggcggagcgggaa
cggaccagggtccaggggatggttgacgcggccgtcgcggccggtgcccgcgtccggacc
ggaggcggccgtcccgacggggagcagtaccagtccggcgcgtggttcgcacccacggtg
ctcacgaacgtgcgtcccgagatggacatcgcgcggcgggaggttttcgggccggtcctg
cccatcattccgttcgacgccgaggccgaggtggtctccgcggccaattcgaccgcctac
ggtctgaccgcctacgtctacacccgagacctctcccgggcgatgcgcatgatcgacgcc
ctggaattcggggaggtctacgtcaaccaggccgggcccgaacaggtgcagggcttccac
acgggctggaaaagctccggcctcggaggcgacgacggcccgcacggctatgagaagtac
ctccggcgcaagaccgtgtacgtgcggcacgctgtctga

DBGET integrated database retrieval system