KEGG   Streptomyces coelicolor: SCO3563Help
Entry
SCO3563           CDS       T00085                                 

Gene name
acsA, SCH5.26
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00620  Pyruvate metabolism
sco00640  Propanoate metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3563 (acsA)
   00620 Pyruvate metabolism
    SCO3563 (acsA)
   00640 Propanoate metabolism
    SCO3563 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SCO3563 (acsA)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SCO3563 (acsA)
Lipid biosynthesis proteins [BR:sco01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SCO3563 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 1098999
NCBI-ProteinID: NP_627761
Kitasato: SCO3563
UniProt: Q9X928
Position
3941251..3943206
Genome map
AA seq 651 aa AA seqDB search
MSNESLANLLKEERRFAPPADLAANANVTAEAYEQAKADRLGFWAEQARRLTWAKEPTET
LDWSNPPFAKWFKDGTLNVAYNCVDRHVEAGNGDRVAIHFEGESGDSRALTYAQLKDEVS
KAANALLELGVQKGDRVAIYMPMIPETAIAMLACARIGAAHSVVFGGFSSDALATRIQDA
DARVVITADGGYRRGKPSALKPAVDEAVERAGIVEHVLVVRRTGQDVAWDDSRDKWWHET
VDGQSAEHTPEAFDAEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHWAVFDLKPETD
VFWCTADVGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPT
AIRTFMKWGDDIPAKFDLSSLRVLGSVGEPINPEAWIWYRKNIGADATPVVDTWWQTETG
AMMITPLPGVTHAKPGSAQRPLPGISATVVDDEANEVPNGGGGYLVLTEPWPSMLRTIWG
DDQRFIDTYWSRFEGKYFAGDGAKKDDDGDIWLLGRVDDVMLVSGHNISTTEVESALVSH
PSVAEAAVVGATDETTGQAIVAFVILRGTTAESEDLVAELRNHVGATLGPIAKPKRILPV
SELPKTRSGKIMRRLLRDVAENRQVGDVTTLADSTVMDLIQTKLPAAPSED
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaatccttggccaacctgctcaaggaagaacgcaggttcgcaccccccgcc
gacctggccgcgaacgccaacgtcacggcggaggcgtacgaacaggccaaggctgacagg
ctcggcttctgggccgagcaggcccgccggctgacctgggcgaaggagccgaccgagacg
ctcgactggtcgaacccgccgttcgccaagtggttcaaggacggcacgctgaacgtcgcc
tacaactgcgtggaccgccacgtggaggccggcaacggcgaccgcgtcgccatccacttc
gagggcgagtccggcgacagccgcgccctcacctacgcccagctcaaggacgaggtctcc
aaggccgccaacgccctgctggagctgggcgtgcagaagggcgaccgggtcgccatctac
atgccgatgatccccgagaccgcgatcgcgatgctggcctgcgcccgcatcggcgccgcg
cactcggtggtcttcggcggcttctcctcggacgcgctggccacccgcatccaggacgcc
gacgcccgcgtcgtcatcaccgccgacggcggctaccggcgcggcaagccgtccgcgctc
aagccggccgtcgacgaggccgtcgagcgcgcggggatcgtcgagcacgtgctcgtcgtc
cgccgcaccggccaggacgtcgcctgggacgactcccgggacaagtggtggcacgagacc
gtcgacgggcagtccgccgagcacacgcccgaggcgttcgacgccgagcacccgctgttc
atcctgtacacgtccggcacgacggggaagcccaagggcatcctgcacacctccggcggc
tacctcacacagacggcgtacacccactgggcggtcttcgacctcaagccggagaccgac
gtcttctggtgcaccgccgacgtcggctgggtcaccggacactcgtacatcgtctacggc
ccgctcgccaacggcgccacccaggtcatgtacgagggcaccccggacaccccgcaccag
ggccgcttctgggagatcgtgcagaagtacggcgtgacgatcctctacacggcgcccacc
gcgatccggacgttcatgaagtggggcgacgacatccccgcgaagttcgacctgtcctcc
ctgcgcgtcctcggctcggtcggcgagccgatcaaccccgaggcgtggatctggtaccgc
aagaacatcggcgcggacgccaccccggtggtcgacacctggtggcagaccgagaccggc
gcgatgatgatcaccccgctgccgggcgtcacccacgccaagccgggctccgcccagcgc
ccgctgcccggcatctccgccaccgtcgtcgacgacgaggccaacgaggtgccgaacggt
ggaggcggctacctggtgctcaccgagccgtggccgtcgatgctgcgcaccatctggggc
gacgaccagcggttcatcgacacctactggtcgcgcttcgagggcaagtacttcgcgggc
gacggcgccaagaaggacgacgacggcgacatctggctgctcggccgcgtcgacgacgtg
atgctcgtctccggccacaacatctccaccaccgaggtggagtcggccctcgtctcccac
ccctcggtcgccgaggcggccgtggtcggcgcgacggacgagacgaccgggcaggccatc
gtggccttcgtgatcctgcgcggcaccaccgcggagagcgaggacctggtcgccgagctg
cgcaaccacgtcggtgccacgctcggcccgatcgccaagcccaagcggatcctgccggtc
tcggagctgccgaagacccgctccggcaagatcatgcggcgcctgctgcgagacgtcgcg
gagaaccggcaggtcggcgacgtcacgacgctggcggactcgacggtcatggacctcatc
cagacgaagctcccggccgcccccagcgaggactga

DBGET integrated database retrieval system