KEGG   Streptomyces coelicolor: SCO3603Help
Entry
SCO3603           CDS       T00085                                 

Gene name
cvrA, nhaP2, ycgO
Definition
(RefSeq) potassium/proton antiporter
  KO
K11105  cell volume regulation protein A
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO3603 (cvrA)
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO3603 (cvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_C Castor_Poll_mid
Motif
Other DBs
NCBI-GeneID: 1099039
NCBI-ProteinID: NP_627798
Kitasato: SCO3603
UniProt: Q9XAJ9
Position
complement(3979806..3981350)
Genome map
AA seq 514 aa AA seqDB search
MTLSELYVMLLIGGTVLLASIAAARAAHRIGLPSLLLFLCVGLVAGEDGLGLRFDDAQLA
QALGAAALALILVEGGLTTRWSDVRKLLAPAGVLATVGVVISVVVTAAGAHWLLGIDWRL
ALLIGAIVSSTDAAAVFAVLRALPLPRKVSVLVEAESGFNDAPTIILVLLFSTTSDLPGP
LPVVGNLLFQLVVGGVLGVVTGRLGVAALRHIALPATGLYPLATVGFGVVAFAAAGALGA
SGIIAAYLSGLVLGNAKLPHRAATRSFSEGVGWLAQIGLFVMLGLLVDPSELPSAILPAL
VVGLVLLLLARPVSVLLCLLPFRVPWREQVFISWAGLRGAVPIVLTTFPVVAGVTGARDA
LNIVFVLVVLFTLLQGPTLPAVARWTGVTRPDALREIQVETAPLDLLDADLLTVSVPPGS
RLHGVTVFELRLPHPTAVTLVVRDGASLVPDRDTVLRAGDELLLITTPQVREAAERRLRA
VGRRGKLARWLGEHGTPESEPLLPMHPEKHHNAQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtccgagctgtacgtgatgctgctgatcggcggcacggtcctgctggccagc
atcgccgcggcccgcgccgcccaccgcatcggcctgcccagcctgctgctgttcctgtgc
gtggggctcgtcgcgggcgaggacgggctcggcctgcgcttcgacgacgcccagctggcc
caggcactgggtgccgccgccctggcgctcatcctggtcgagggcgggctgaccacccgg
tggagcgacgtccggaagctgctcgctccggccggagtgctcgccacggtgggtgtggtg
atctccgtggtggtgaccgccgcgggcgcgcactggctgctggggatcgactggcggctg
gccctgctgatcggtgcgatcgtctcctccaccgacgccgccgccgtcttcgccgtactg
cgcgccctgccgctgccgcgcaaggtgagcgtgctggtggaggccgagtcaggcttcaac
gacgcgcccaccatcatcctggtcctgctcttctccaccacctccgatctgccgggcccg
ctccccgtcgtgggcaacctcctcttccagctcgtggtcggcggcgtcctgggcgtggtg
accggccgcctgggcgtcgccgcgctgcggcacatcgccctgcccgcgaccggcctgtac
ccgcttgccaccgtcggtttcggcgtcgtcgccttcgccgccgccggagcgctgggcgcc
agcggcatcatcgccgcctacctctccgggctcgtcctcggcaacgccaagctgccccac
cgcgcggccacccgctccttctccgagggcgtcgggtggctggcccagatcgggctgttc
gtcatgctcggcctgctcgtcgacccgagcgaactgccgtccgcgatcctcccggccctg
gtcgtgggcctggtcctgctgctgctcgcccggccggtgtcggtcctgctctgcctgctg
ccgttccgggtgccctggcgcgagcaggtcttcatctcctgggccggtctgcgcggcgcg
gtccccatcgtgctcacgaccttccccgtcgtggcgggggtgaccggtgcgcgcgacgcc
ctgaacatcgtgttcgtgctcgtcgtcctcttcaccctgctccaggggcccacactgccc
gccgtggcgcggtggacgggggtgacccgtccggacgcgctgcgcgagatccaggtcgag
acggcgccgctcgacctcctggacgccgacctgctcaccgtgtccgtcccgccgggttcg
cggctgcacggcgtcaccgtcttcgaactgcggctgccgcatccgacggccgtcaccctg
gtcgtccgcgacggcgccagtctcgtccccgaccgcgacaccgtgctgcgcgccggcgac
gaactgctcctcatcaccacaccccaggtccgggaggcggcggaacgccggctgcgcgcc
gtcggccgccgcggcaaactggcccgctggctgggcgagcacggcactccggagtccgag
cccttgctccccatgcaccccgaaaagcatcacaatgcgcaataa

DBGET integrated database retrieval system