KEGG   Streptomyces coelicolor: SCO3614Help
Entry
SCO3614           CDS       T00085                                 

Gene name
asd2, SC66T3.25c
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00261  Monobactam biosynthesis
sco00270  Cysteine and methionine metabolism
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
sco_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3614 (asd2)
   00270 Cysteine and methionine metabolism
    SCO3614 (asd2)
   00300 Lysine biosynthesis
    SCO3614 (asd2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3614 (asd2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SCO3614 (asd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh Sacchrp_dh_NADP DXP_reductoisom
Motif
Other DBs
NCBI-GeneID: 1099050
NCBI-ProteinID: NP_627809
Kitasato: SCO3614
UniProt: Q9XAI8
Position
complement(3993330..3994418)
Genome map
AA seq 362 aa AA seqDB search
MSARQDTGRDGGRTGRPTLAVVGATGAVGSVMLQILSQHADVWGDIRLIASPRSAGRKLA
VRGEEVEVVALSEEAFDGVDVAMFDVPDEVAAQWAPLAAAKGAVVVDNSGAFRMDPDVPL
VVPEVNPHAVRMRPRGIVANPNCTTLSMIVALGALHAEFGLRELVVSSYQAVSGAGRDGV
DTLRRQLSLVAGTELGTHPGDVRRAVGDDTGPFPEPVALNVVPWAGSLREDGWSSEEMKV
RDESRKILGLPNLPVAVTCVRVPVVTTHSLTVHARFEGEVSVQGAREILATAPGVVLFDN
PAAGEFPTPADAVGTDPTWVGRVRRALDDPTALELFVCGDNLRKGAALNTAQIAELVAAE
FG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaggcaagacaccggccgggacggcggccgtaccggccggcccacgctcgcc
gtcgtgggcgcgaccggtgccgtcggctcggtcatgctccagatcctgtcccagcacgcg
gacgtctggggcgacatccgcctgatcgcctccccgcgctcggccggccgcaagctggcc
gtgcggggggaggaggtcgaggtcgtcgcgctgagcgaagaggccttcgacggggtcgac
gtcgccatgttcgacgtgcccgacgaggtcgccgcccagtgggcgccgctcgccgccgcc
aagggcgcggtggtcgtcgacaactccggcgccttccggatggacccggacgtgccgctg
gtcgtgcccgaggtcaatccgcacgcggtgcggatgcggccgcgcgggatcgtcgccaac
ccgaactgcacgacgctgtccatgatcgtggcgctgggcgcgctgcacgccgagttcggg
ttgcgcgagctggtcgtctcctcgtaccaggcggtcagcggggccgggcgggacggcgtg
gacacgctgcgccggcagctgtcgctggtggccggcaccgagctggggacgcaccccggt
gacgtgcggcgggccgtcggcgacgacaccgggccgttcccggagccggtcgcgctgaac
gtcgtaccgtgggccggatcgctgcgggaggacggctggtcgtcggaggagatgaaggtg
cgggacgagtcccgcaagatcctcgggctgccgaacctcccggtcgcggtgacatgcgta
cgggtgcccgtcgtcaccacgcactccctgaccgtgcacgcccgcttcgagggcgaggtc
agtgtccagggggcccgggagatcctggccaccgctcccggcgtcgtcctgttcgacaac
ccggccgcgggggagttcccgacgcccgccgacgcggtcggcaccgacccgacctgggtc
ggccgggtgcgccgggccctggacgacccgaccgcgctcgaactcttcgtctgcggggac
aatctgcgcaagggcgccgcgctcaacaccgcgcagatcgcggagttggtggcggccgag
ttcggctga

DBGET integrated database retrieval system