KEGG   Streptomyces coelicolor: SCO3629Help
Entry
SCO3629           CDS       T00085                                 

Gene name
purA, SCH10.07c
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
Module
sco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO3629 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO3629 (purA)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SCO3629 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 1099065
NCBI-ProteinID: NP_627823
Kitasato: SCO3629
UniProt: Q9X8P6
Position
complement(4006900..4008183)
Genome map
AA seq 427 aa AA seqDB search
MPALVLLGAQWGDEGKGKATDLLGGSVDYVVRYQGGNNAGHTVVVGDQKYALHLLPSGIL
SPGCTPVIGNGVVVDPSVLFSELSGLNERGVDTSKLLISGNAHIITPYNVTVDKVTERFL
GKRKIGTTGRGIGPTYADKINRVGIRVQDLYDESILTQKVEAALDVKNQMLTKLYNRRAI
ATGQVVEELLGYADKLAPYVADTVLVLNQALDDDKVVLFEGGQGTLLDIDHGTYPFVTSS
NPTAGGACTGAGVGPTKISRVIGILKAYTTRVGAGPFPTELFDEDGEALRRIGGERGVTT
GRDRRCGWFDAVIARYATRVNGLTDFFLTKLDVLTGWEQIPVCVAYEIDGKRVEELPYSQ
SDFHHAKPVYETLPGWSEDITKAKSFSDLPKNAQAYVKALEEMSGAPISAIGVGPGRDET
IEINSFL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcacttgtgctgctcggtgctcagtggggtgacgaaggcaagggaaaggcgacg
gacctgctcggtggctccgtcgactatgtggtgcgctaccagggcggcaacaacgccggc
cacacggtagtcgtgggcgaccagaagtacgccctgcacctgctcccttccgggattctc
tcccccggctgcacgccggtcatcggaaacggcgtcgtcgtcgacccgtcggtcctgttc
tccgagctgagcgggctgaacgagcgcggcgtcgacacgtccaagctcctgatcagcggc
aacgctcacatcatcacgccgtacaacgtcaccgtcgacaaggtgacggaacgcttcctc
ggcaagcgcaagatcggcaccaccgggcgcggcatcggcccgacctacgccgacaagatc
aaccgcgtgggcatccgggtgcaggacctctacgacgagtcgatcctcacccagaaggtc
gaggcggcgctcgacgtcaagaaccagatgctcaccaagctctacaaccgccgcgccatc
gccaccggccaggtcgtcgaggagctgctgggctacgccgacaagctcgccccgtacgtc
gccgacaccgtcctggtcctcaaccaggccctcgacgacgacaaggtggtcctcttcgag
ggcggccagggcaccctcctggacatcgaccacggcacgtaccccttcgtcacctcgtcg
aacccgaccgcgggtggcgcctgcaccggcgccggcgtgggcccgacgaagatcagccgg
gtcatcggcatcctcaaggcgtacacgacccgcgtcggtgccggaccgttcccgaccgag
ctgttcgacgaggacggcgaggccctgcgccgcatcggcggcgagcgcggcgtcaccacc
ggccgcgaccggcgctgcggctggttcgacgcggtgatcgcccgctacgccacccgcgtc
aacggcctcaccgacttcttcctcaccaagctcgacgtcctcaccggctgggagcagatc
ccggtctgcgtggcctacgagatcgacggcaagcgcgtcgaggagctgccgtactcgcag
tccgacttccaccacgcgaagccggtctacgagacgctgcccggctggagcgaggacatc
accaaggcgaagtccttctccgacctgccgaagaacgcccaggcgtacgtcaaggccctg
gaggagatgtccggcgccccgatctccgcgatcggcgtcggcccgggccgggacgagacg
atcgagatcaactcgttcctgtag

DBGET integrated database retrieval system