KEGG   Streptomyces coelicolor: SCO3649Help
Entry
SCO3649           CDS       T00085                                 

Gene name
fba, SCH10.27c
Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00030  Pentose phosphate pathway
sco00051  Fructose and mannose metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3649 (fba)
   00030 Pentose phosphate pathway
    SCO3649 (fba)
   00051 Fructose and mannose metabolism
    SCO3649 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO3649 (fba)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SCO3649 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 1099085
NCBI-ProteinID: NP_627843
Kitasato: SCO3649
UniProt: Q9X8R6
Position
complement(4027742..4028773)
Genome map
AA seq 343 aa AA seqDB search
MPIATPEVYNEMLDRAKAGKFAYPAINVTSSQTLHAALRGFAEAESDGIVQISTGGAEFL
GGQHNKDMVTGAVALAEFAHIVAEKYDVTVALHTDHCPKDKLDGYVRPLIAVSEERVKAG
RNPLFQSHMWDGSAETLADNLSIAQELLARARAARIILEVEITPTGGEEDGVSHEINDSL
YTTVDDAVRTVEALGLGEKGRYLLAASFGNVHGVYKPGNVVLRPELLKELNEGIASKYGQ
PAGSKPFDFVFHGGSGSTAEEIATALENGVVKMNIDTDTQYAFTRPVVDHMFRNYDGVLK
VDGEVGNKKTYDPRTWGKLAEAGMAARVVEACGHLRSAGQKIK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgcaactcccgaggtctacaacgagatgctggaccgggcgaaggcaggaaag
ttcgcctaccccgccatcaacgtgacctcttcccagacgctgcacgccgccctgcgcggc
ttcgcggaggcggagagcgacggcatcgtccagatctccaccggcggcgccgagttcctg
ggcggccagcacaacaaggacatggtgaccggcgccgtcgccctcgccgagttcgcgcac
atcgtcgccgagaagtacgacgtcaccgtcgccctgcacacggaccactgccccaaggac
aagctcgacgggtacgtacgcccgctgatcgccgtctccgaggagcgcgtcaaggccggc
cgcaacccgctgttccagtcgcacatgtgggacggctcggccgagaccctggccgacaac
ctctccatcgcccaggagctgctggcgcgcgcccgcgccgccaggatcatcctcgaggtc
gagatcaccccgaccggcggcgaggaggacggcgtctcccacgagatcaacgactccctg
tacaccacggtcgacgacgcggtccgcaccgtcgaggccctgggcctgggcgagaagggc
cgctacctgctcgccgcgtccttcggcaacgtgcacggcgtctacaagccgggcaacgtc
gtgctccgccccgagctgctcaaggagctgaacgagggcatcgcgtcgaagtacggccag
ccggccggcagcaagccgttcgacttcgtcttccacggcggctccggctccaccgccgag
gagatcgcgaccgccctggagaacggcgtggtcaagatgaacatcgacacggacacccag
tacgccttcacgcgtccggtcgtcgaccacatgttccgcaactacgacggcgtcctcaag
gtcgacggcgaggtcggcaacaagaagacgtacgacccgcgcacctggggcaagctggcc
gaggccggcatggccgcgcgcgtcgtggaggcctgcggccacctgcgctcggcgggccag
aagatcaagtaa

DBGET integrated database retrieval system