KEGG   Streptomyces coelicolor: SCO3650Help
Entry
SCO3650           CDS       T00085                                 

Gene name
pyrE
Definition
(RefSeq) orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO3650 (pyrE)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     SCO3650 (pyrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_2 Glyco_trans_4_5
Motif
Other DBs
NCBI-GeneID: 1099086
NCBI-ProteinID: NP_627844
Kitasato: SCO3650
UniProt: Q9X8R7
Position
complement(4028946..4029494)
Genome map
AA seq 182 aa AA seqDB search
MTDVRGELLQQIKDKAVVHGKVTLSSGLEADYYVDLRRITLDGEAAPLVGQVLLDLTADL
EFDAVGGLTMGADPVAASMLHAAAARGRRLDAFVVRKTAKAHGLQRRVEGPEIKGRRVVV
VEDTSTTGGSPLTAVEAVREAGAEVVAVATIVDRATGAGEKIQDGAGVPYLYAYGKDELG
LD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtacgcggcgagctgctgcagcagatcaaggacaaggccgtggtgcacggc
aaggtcaccctctcctcggggctggaggccgactactacgtcgacctgcgccgcatcacc
ctcgacggcgaggccgcgccgctggtcggccaggtgctgctggacctcaccgccgacctg
gagttcgacgcggtgggcgggctcaccatgggcgccgacccggtcgccgcgagcatgctg
cacgccgccgccgcgcgcggccgcaggctggacgcgttcgtcgtccgcaagaccgccaag
gcgcacgggctgcagcgccgcgtcgagggcccggagatcaagggccgccgcgtcgtggtc
gtcgaggacacctccaccaccggcggctccccgctcaccgccgtcgaggccgtgcgcgag
gccggcgccgaggtggtcgccgtggcgacgatcgtcgaccgggcgaccggggccggcgag
aagatccaggacggcgcgggggtgccgtacctgtacgcgtacggcaaggacgagctgggc
ctggactga

DBGET integrated database retrieval system