KEGG   Streptomyces coelicolor: SCO3658Help
Entry
SCO3658           CDS       T00085                                 

Gene name
SCH10.36
Definition
(RefSeq) aminotransferase
  KO
K14267  N-succinyldiaminopimelate aminotransferase [EC:2.6.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SCO3658 (SCH10.36)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO3658 (SCH10.36)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.17  succinyldiaminopimelate transaminase
     SCO3658 (SCH10.36)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class I
   SCO3658 (SCH10.36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 1099094
NCBI-ProteinID: NP_627852
Kitasato: SCO3658
UniProt: Q9X8S5
Position
4036689..4037879
Genome map
AA seq 396 aa AA seqDB search
MTSMSSSARPLLNRRLAEFGTTIFAEMSALAVRTGAINLGQGFPDTDGPEEVREAAVRAL
RDGRGNQYPPGPGVPELRAAVAGHQQRRYGLSYDPDTEVLVTAGATEAIAAALLALLEPG
DEVVALEPYYDSYAACIAMAGGTRVPVTLRPHEGTFRLDLDELRDAVTDRTRLLLLNTPH
NPTGTVLTRDELAAIAELAVERDLLVVTDEVYEHLVFGTAEHIPLASFPGMRERTVTIGS
AGKTFSFTGWKVGWVTAAPALLTAVRSAKQYLTYVASGPFQYAVAEALALPESYFAAYRQ
DMEAKRDLLAAGLAEAGFGVYRPAGTYFVTTDIRPLGERDGFAFCRSLPERAGVVAVPNA
VFYNHREEGAPFVRFAFCKRLPVLEEAVGRLKTLSA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgatgagctccagcgcccgccccctcctgaaccgccggctcgcggagttcggg
acgacgatcttcgccgagatgtccgccctggcggtgcggaccggggcgatcaacctcggc
cagggcttccccgacaccgacggccccgaggaggtccgggaggccgcggtgcgggcactg
cgcgacgggcgcggcaaccagtaccccccgggcccgggcgtccccgagctgcgcgccgcc
gtcgccggccaccagcagcgccgctacggcctgtcctacgaccccgacaccgaggtcctg
gtcaccgccggcgccacggaggccatcgcggccgccctgctggccctgctggagcccggc
gacgaggtcgtcgcgctggagccgtactacgactcgtacgcggcctgcatcgcgatggcg
ggcggcacccgcgtgccggtgaccctgcggccgcacgagggcacgttccgtctggacctg
gacgagctgcgcgacgcggtcaccgaccgcacccgcctgctgctgctgaacaccccgcac
aacccgacgggcacggtcctcacccgcgacgagctggccgcgatcgccgagctggcggtg
gagcgcgacctgctggtggtgaccgacgaggtctacgagcacctggtcttcggcaccgcc
gagcacatccccctggcgtccttcccggggatgcgggagcgcacggtgaccatcgggtcg
gccggcaagacgttctcgttcaccggctggaaggtcggctgggtcaccgccgcgcccgcc
ctgctcacggcggtccgctcggccaagcagtacctgacgtacgtggcctcggggcccttc
cagtacgccgtcgccgaggcgctcgcgctgccggagtcgtacttcgccgcctaccggcag
gacatggaggcgaagcgggacctgctggccgcgggcctggccgaggcgggcttcggcgtg
taccgccccgccgggacgtacttcgtcaccaccgacatccgcccgctcggcgagcgcgac
ggcttcgccttctgccgctccctgcccgagcgcgcgggcgtcgtcgccgtccccaacgcg
gtcttctacaaccaccgggaggagggcgcgcccttcgtgcggttcgcgttctgcaagcgg
ctgccggtgctggaggaggcggtggggcggctcaagacgctctcggcgtga

DBGET integrated database retrieval system