KEGG   Streptomyces coelicolor: SCO3678Help
Entry
SCO3678           CDS       T00085                                 

Gene name
dcd
Definition
(RefSeq) deoxycytidine triphosphate deaminase
  KO
K01494  dCTP deaminase [EC:3.5.4.13]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO3678 (dcd)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     SCO3678 (dcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DCD dUTPase
Motif
Other DBs
NCBI-GeneID: 1099114
NCBI-ProteinID: NP_627870
Kitasato: SCO3678
UniProt: Q9X8W0
Position
complement(4061079..4061654)
Genome map
AA seq 191 aa AA seqDB search
MLLSDKDIRAEIDNGRVRIDPFDDSMVQPSSIDVRLDRYFRVFENHRYPHIDPSVEQVDL
TRLVEPEGDEPFILHPGEFVLASTYEVVSLPDDLASRLEGKSSLGRLGLVTHSTAGFIDP
GFSGHVTLELSNLATLPIKLWPGMKIGQLCLFRLTSPAEHPYGSERYGSRYQGQRGPTAS
RSFLNFHRTQV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgcttctctcagacaaggacatccgggccgagatcgacaacgggcgggtgcggatcgat
ccgttcgacgactccatggtgcagccgtcgagcatcgacgtgcgtctcgaccgctacttc
cgggtgttcgagaatcaccggtacccgcacatcgacccctccgtcgagcaggtggatctg
acccggctcgtggagcccgagggcgacgagccgttcatcctgcaccccggcgagttcgtg
ctggccagtacgtacgaggtcgtctcgctgccggacgatctcgcctcgcggctggagggg
aagagttcgctcgggcggctcgggctggtcacgcactccaccgccgggttcatcgacccg
gggttctccgggcacgtgacgctggagctgagcaatctcgcgaccctgccgatcaagctg
tggccggggatgaagatcgggcagctgtgcctgttccggctcacctcgccggccgagcac
ccgtacgggagcgagcgctacgggtcccgctaccagggccagcgggggccgaccgcctcc
cggtccttcctcaatttccatcggacccaggtatga

DBGET integrated database retrieval system