KEGG   Streptomyces coelicolor: SCO3815Help
Entry
SCO3815           CDS       T00085                                 

Gene name
bkdC1, SCGD3.16c
Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3815 (bkdC1)
   00020 Citrate cycle (TCA cycle)
    SCO3815 (bkdC1)
   00620 Pyruvate metabolism
    SCO3815 (bkdC1)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCO3815 (bkdC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 1099251
NCBI-ProteinID: NP_628004
Kitasato: SCO3815
UniProt: Q9XA62
Position
complement(4193532..4194941)
Genome map
AA seq 469 aa AA seqDB search
MTDSSVREFKMPDVGEGLTEAEILKWYVQPGDTVTDGQVVCEVETAKAAVELPIPYDGVV
RELHFPEGTTVDVGTSIIAVAVGDGAAAAAEPVQEAVAEEPKPEGRQPVLVGYGVSTSST
KRRPRKGAEAPAAAQTPAAAIQAELNGHGQAAPAAPATPAAPVTGDRPLAKPPVRKLAKD
LGVDLATVVPSGPDGIITREDVHAAVSAPEPAQAAAPRSEQAAPAPSPSAPSSYDTTRET
RVPVKGVRKATAAAMVGSAFTAPHVTEFVTVDVTRTMKLVEELKQDKEYTGLRVNPLLLI
AKALLVAIRRNPDVNASWDEAAQEIVVKHYVNLGIAAATPRGLIVPNIKDAHAQTLPQLA
GSLGELVSTAREGKTSPAAMQGGTVTITNVGVFGVDTGTPILNPGESAILAVGAIKLQPW
VHKGKVKPRQVTTLALSFDHRLVDGELGSKVLADVAAVLEQPKRLISWA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagctccgtgcgtgagttcaagatgcccgacgtgggcgaggggctcaccgag
gccgagatcctcaagtggtacgtccagcccggtgacacggtcaccgacggccaggtggtg
tgcgaggtcgagacggccaaggccgccgtcgaactgcccatcccctacgacggcgtggtc
cgcgagctgcacttccccgagggcaccacggtcgacgtgggtacgtcgatcatcgcggtg
gccgtcggcgacggcgcggcggcggccgcggagccggtgcaggaggccgtggcggaggag
cccaagccggagggccgccagccggtcctggtcgggtacggggtctccacctcctcgacc
aagcgccgtccccgcaaaggcgcggaggccccggccgccgcgcagacaccggcggcggcg
atccaggccgagctgaacggccacggccaggcagcgcccgcggcgcccgcgacaccggcc
gcgccggtcaccggcgaccgcccgctggccaagcctccggtgcgcaagctcgccaaggac
ctgggcgtcgacctggcgaccgtggtcccgtccggcccggacggcatcatcacccgcgag
gacgtgcacgcggcggtgtcggcgcccgagccggcccaggcggcggccccgcgttccgag
caggccgcgcccgctccgtccccgtcggccccgtcgtcgtacgacacgacgcgcgagacc
cgtgtcccggtcaagggcgtgcgcaaggcgacggcggcggcgatggtcggttcggcgttc
accgcgccgcacgtcaccgagttcgtgacggtcgacgtgacgcgcacgatgaagctggtc
gaggagctgaagcaggacaaggagtacacgggcctgcgggtgaacccgctgctcctgatc
gccaaggccctcctcgtcgcgatcaggcgcaacccggacgtcaacgcgtcctgggacgag
gcggcccaggagatcgtggtcaagcactacgtcaacctgggcatcgccgccgccaccccg
cgcggtctgatcgtcccgaacatcaaggacgcccacgcgcagaccctgccgcagctggcg
ggttcgctgggcgagctggtgtcgacggccagggagggcaagacctccccggccgccatg
cagggcggcacggtgaccatcaccaacgtcggcgtcttcggcgtcgacaccggcacgccg
atcctcaacccgggcgagtccgcgatcctggcggtcggtgcgatcaagctccagccgtgg
gtccacaagggcaaggtgaagccccgccaggtcaccaccctcgcgctgagcttcgaccac
cgcctggtcgacggcgagctgggctccaaggtcctcgccgacgtcgcggcggtcctggag
cagccgaagcggttgatcagctgggcctga

DBGET integrated database retrieval system