KEGG   Streptomyces coelicolor: SCO3831Help
Entry
SCO3831           CDS       T00085                                 

Gene name
bkdA2, SCGD3.32c, SCH69.01c
Definition
(RefSeq) E1-alpha branched-chain alpha keto acid dehydrogenase
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3831 (bkdA2)
   00020 Citrate cycle (TCA cycle)
    SCO3831 (bkdA2)
   00620 Pyruvate metabolism
    SCO3831 (bkdA2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SCO3831 (bkdA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 1099267
NCBI-ProteinID: NP_733618
Kitasato: SCO3831
UniProt: Q8CJV5
Position
complement(4213272..4214438)
Genome map
AA seq 388 aa AA seqDB search
MTVMEQRGAYRPTPPPAWQPRTDPAPLLPDTEPYRVLGTKAADRADTELLRTLYARLVRG
RRYNAQATALTKQGRLAVYPSSTGQEACEIAAALALEERDWLFPSYRDTLAVVSRGVDPV
EALTLLRGDWHTGYDPYEHRVAPLSTPLATQLPHAVGLAHAARLKGDDVVALAMVGDGGT
SEGDFHEALNFAAVWRAPVVFLVQNNGFAISVPLDKQTAAPSLAHKAVGYGMPGRLVDGN
DAAAVHEVLSDAVRHARAGGGPTLVEAVTYRVDAHTNADDATRYRGDAEVETWRRHDPVE
LLERELTERGLLDEDGIRAAREDAETMAADLRARMNQDPELDPLELFAHVYAEPTPQLRE
QRDQLRAELAAEAETAARQAGALEGGRR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcatggagcagcggggcgcttaccggcccacaccgccgcccgcctggcagccc
cgaaccgaccccgcgccgctgctgcccgacacggagccctaccgcgtcctcggcaccaag
gccgcggaccgcgccgacaccgagctgctgcgcacgctgtacgcgcggctggtgcgcggc
cggcgctacaacgcgcaggccacggcgctcaccaagcagggccggctggccgtctacccc
tccagcaccggccaggaggcgtgcgagatcgccgccgcgttggccctcgaggagcgggac
tggctcttccccagctaccgcgacaccctcgcggtcgtctcgcgcggcgtcgaccccgtc
gaggccctcaccctgctgcgcggcgactggcacaccggctacgacccctacgagcaccgg
gtcgccccgctgtccacgccgctggccacccagctgccgcacgccgtgggtctcgcccac
gccgcccgcctcaagggcgacgacgtggtcgccctggccatggtcggcgacggcggcacc
agcgagggcgacttccacgaggcgctgaacttcgccgccgtctggcgggccccggtcgtc
ttcctcgtgcagaacaacggcttcgcgatctccgtcccgctcgacaagcagaccgccgcc
ccgtcgctggcccacaaggccgtcggctacgggatgcccggccgcctggtcgacggcaac
gacgccgccgcggtgcacgaggtcctgtccgacgccgtgcgccacgcacgcgcgggcggc
ggtcccaccctggtggaggcggtgacgtaccgcgtcgacgcgcacaccaacgccgacgac
gccacccgctaccggggcgacgccgaggtggagacctggcggcggcacgacccggtcgag
ctgctggagcgggagctgaccgagcgcggcctgctcgacgaggacggcatccgcgccgcc
cgcgaggacgccgagaccatggccgccgacctgcgcgcccggatgaaccaggaccccgag
ctggaccccctggagctgttcgcccacgtctacgccgagcccaccccgcagctgcgcgag
cagcgggaccagctccgcgcggagctggccgcggaggccgagaccgcggcacggcaggcc
ggagcactggaaggggggcgtcgatga

DBGET integrated database retrieval system