KEGG   Streptomyces coelicolor: SCO3834Help
Entry
SCO3834           CDS       T00085                                 

Gene name
SCH69.04c
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sco  Streptomyces coelicolor
Pathway
sco00360  Phenylalanine metabolism
sco00362  Benzoate degradation
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO3834 (SCH69.04c)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO3834 (SCH69.04c)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO3834 (SCH69.04c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SCO3834 (SCH69.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C MORN
Motif
Other DBs
NCBI-GeneID: 1099270
NCBI-ProteinID: NP_628022
Kitasato: SCO3834
UniProt: Q9XA30
Position
complement(4215803..4217317)
Genome map
AA seq 504 aa AA seqDB search
MTALDPSSPVAVVGTGTMGQGIAQVALVAGHPVRLYDAVDGRAREAADAIGARLDRLVEK
DRLTGAERDAARARLVPAGTLGELADCALVVEAVVERLDVKQELFRALEDVVGDDCLLAT
NTSSLSVTAVGGALRVPGRFVGLHFFNPAPLLPLVEVVSGFATDPASATRAYETARAWGK
TPVACADTPGFVVNRVARPFYAEALAAYEARAADPATVDAVLRESGGFRMGAFELTDLIG
QDVNESVTHSVWQSFFQDVRFTPSLAQRRLVESGRLGRKSGQGWYDYRDGADRPAPHTAE
PAGAPAHVVVEGDLGPAAELVALIREAGIEVRPEDGYGAGRLVLPDGGTLSLTDGQLPVS
KDLVHFDLALDYRAATRIALSASRGVRPGLLSEATGLFQALGKKVSVIGDIPGMIVARTV
ARIIDLAFDAVAKGVAAPEDVDTAMRLGVNYPLGPFEWSRRLGDTWAYYLLADVHEWEPS
GRCAPSLALHRHAEAAEDREGAAS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacagcactcgaccccagcagccccgtggccgtcgtcggcaccggcaccatgggccag
ggcatcgcccaggtggcactggtcgcgggccaccccgtgcggctgtacgacgccgtcgac
gggcgcgcccgggaggcggccgacgcgatcggcgcccggctcgaccggctcgtcgagaag
gaccgcctcaccggcgccgaacgggacgccgcccgcgcccggctcgtgcccgccgggacc
ctcggcgaactggccgactgcgccctcgtcgtcgaggcggtcgtggagcgtcttgacgtc
aagcaggagctgttccgcgcgctggaggacgtcgtgggcgacgactgcctgctcgccacc
aacacctcctccctgtccgtcaccgcggtcggcggcgcactgcgcgtccccggccgcttc
gtgggcctgcacttcttcaaccccgcgccactgctcccgctggtggaggtggtctccggg
ttcgccaccgacccggcgtcggccacgcgcgcgtacgagacggcacgcgcctggggcaag
accccggtggcctgcgccgacacccccggcttcgtcgtcaaccgcgtcgcccggcccttc
tacgccgaggccctcgcggcgtacgaggcacgggcggccgacccggccaccgtcgacgcc
gtactgcgcgagtcgggcggcttcaggatgggcgccttcgagctgaccgacctcatcggc
caggacgtcaacgagtccgtcacgcactccgtgtggcagtcgttcttccaggacgtgcgc
ttcaccccgtccctggcccagcgccgcctggtcgagtccggccggctcggccgcaagagc
gggcagggctggtacgactaccgcgacggcgccgaccgccccgcgccgcacaccgccgaa
ccggccggggcgcccgctcacgtcgtcgtcgagggggacctgggaccggccgccgagctg
gtcgcgctgatccgcgaggcgggcatcgaggtgcgtccggaggacgggtacggcgcggga
cggctcgtcctgcccgacggcggcacgctgagcctcaccgacgggcagctgcccgtgtcg
aaggacctcgtccacttcgacctcgccctcgactaccgcgcggccacccggatcgccctg
tccgcgtcccggggcgtccgtccgggcctcctgtccgaggccacgggcctgttccaggcg
ctcggcaagaaggtcagcgtcatcggcgacatccccgggatgatcgtggcccggaccgtc
gcccggatcatcgacctggcgttcgacgccgtggccaagggcgtggccgcccccgaggac
gtcgacacggcgatgcgcctgggtgtgaactaccccctcggccccttcgaatggagccgt
cggctcggtgacacctgggcctactacctgctggccgacgtgcacgagtgggaaccgtcc
gggcgctgcgcgccgtccctggccctccaccgccacgccgaggccgccgaggaccgggag
ggtgcagcctcatga

DBGET integrated database retrieval system