KEGG   Streptomyces coelicolor: SCO3920Help
Entry
SCO3920           CDS       T00085                                 

Gene name
cysA, SCQ11.03c
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00270  Cysteine and methionine metabolism
sco00450  Selenocompound metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3920 (cysA)
   00270 Cysteine and methionine metabolism
    SCO3920 (cysA)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO3920 (cysA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO3920 (cysA)
Enzymes [BR:sco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     SCO3920 (cysA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3920 (cysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1099356
NCBI-ProteinID: NP_628105
Kitasato: SCO3920
UniProt: Q59829
Position
complement(4315547..4316725)
Genome map
AA seq 392 aa AA seqDB search
MSDSATTDSAGTGGERSASAPGDGTRAVRAGLPEPVKHEPTLPGPVFAAHFHLPGDPTGP
YTYGRDENPTWTRLESAIGELEAPGEAGVETLVFASGMAAISSVLFSQLRAGDTAVLPDD
GYQALPLVRAQLEAYGIEVRTAPTGRDAQLDVLDGAKLLWIETPSNPGLDVCDVRRLVEA
AHAGGALVAVDNTLATPLGQRPLELGADFSVASGTKQLTGHGDVLLGYVAGRDAGAMAAV
RRWRKIVGAIPGPMEAWLAHRSIATLQLRVDRQDSTALKVAEALRTRPEITGLRYPGLPD
DPSHKVASQQMLRYGCVVSFTLPSRARADRFLDALRLVEGATSFGGVRSTAERRGRWGGD
AVPEGFIRLSVGAEDPDDLVADLLRALDETTE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccgctaccaccgacagcgccggtacgggcggggagagatccgcttccgct
cccggtgacggcacgcgcgcggtgcgggccgggctgcccgaaccggtcaagcacgaaccc
accctgccgggcccggtgttcgccgcccacttccacctgccgggggatccgaccgggccg
tacacctacggccgcgacgagaacccgacctggacccgcctcgagagcgccatcggcgag
ctggaggcgcccggagaggccggcgtggagacactcgtcttcgcctcgggcatggccgcg
atctcctcggtgctcttctcgcagctgcgcgccggcgacacggccgtcctgcccgacgac
ggctatcaggcgctgccactggtccgggctcagctggaggcgtacggcatcgaggtgcgc
accgcgccgaccggccgggacgcgcagctcgacgtcctggacggggcgaagctgctgtgg
atcgagacgccgtcgaacccggggctcgacgtgtgcgacgtacggcggctcgtcgaggcg
gcgcacgcgggcggtgccctggtggccgtcgacaacaccctcgccaccccgctcgggcag
cgcccgctggagctcggcgcggacttctcggtggccagcggaaccaagcagctcaccggc
cacggagacgtcctgctgggctacgtggccggccgcgacgccggggcgatggccgccgtt
cggcgctggcgcaagatcgtcggtgcgattcccggccccatggaggcctggctcgcgcac
cgctcgatcgccaccctccagctgcgcgtggaccggcaggactccaccgcgctcaaggtg
gccgaagccctccgcacccggcccgagatcaccggcctgcggtaccccgggctgccggac
gacccgtcccacaaggtcgcctcgcagcagatgctgcgctacggctgtgtcgtctccttc
acgctgccctcgcgcgcgcgtgccgatcgttttctcgacgcgctgcgcctcgtcgagggc
gcgacgagcttcggcggggtgcggtccacggcggagcggcgcgggcgctggggcggcgac
gcggtgccggagggcttcatccggctctccgtcggcgcggaggaccccgacgacctggtg
gccgatctgctgcgcgcgctggacgaaacgacggaatga

DBGET integrated database retrieval system