KEGG   Streptomyces coelicolor: SCO3945Help
Entry
SCO3945           CDS       T00085                                 

Gene name
cydA, SCD78.12
Definition
(RefSeq) cytochrome oxidase subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00190  Oxidative phosphorylation
sco01100  Metabolic pathways
sco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCO3945 (cydA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCO3945 (cydA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     SCO3945 (cydA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I
Motif
Other DBs
NCBI-GeneID: 1099381
NCBI-ProteinID: NP_628129
Kitasato: SCO3945
UniProt: Q9ZBY7
Position
4340932..4342437
Genome map
AA seq 501 aa AA seqDB search
MDLALAPETLARWQFGITTVYHFLFVPLTISLAALTAGLQTAWVRTEKEKYLRATKFWGK
LFLINIAMGVVTGIVQEFQFGMNWSDYSRFVGDVFGAPLAFEALIAFFFESTFIGLWIFG
WDKLPKKIHLACIWMVSIGTLLSAYFILAANSWMQHPVGYRINEEKGRAELTDFWQVLTQ
NTTLNQVFHSFSAAFLTGGAFMVGIAAFHLMRKKHIPVMRTSLRLGLVTLAVGGLLTAVS
GDTLGKVMYEQQPMKMAAAEALWDGEKPAPFSVFAYGDVDKGHNKVALEVPGLLSFLAHS
DFESYVPGINDTNKALQEQFGPGDYKPIVPVAYWGFRWMIGFGMASFSLGLLGLWLTRKR
FLLPPALRTGEDEVPHLVLLKKPLGARLTRMYWLLALWTMAFPLIANSWGWIFTEMGRQP
WVVYGVMQTRDAVSPGVSTAEVIISMSVFTLLYAVLAVIEVKLLAKYVKAGPPELTEADL
NPPTKIGGDLRDADKPMAFSY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggacctggctctggcgccggagacgctggcgcgatggcagttcggcatcacgaccgtc
taccacttcctgttcgtcccgctgacgatctcgctggccgccctcacggccggactgcag
accgcctgggtccgcacggagaaggagaagtacctcagggcgaccaagttctggggcaag
ctcttcctgatcaacatcgcgatgggtgtcgtcaccggcatcgtgcaggagttccagttc
ggcatgaactggtccgactactcccgcttcgtcggcgacgtcttcggcgccccgctcgcc
ttcgaggcgctgatcgccttcttcttcgagtccaccttcatcggcctgtggatcttcggc
tgggacaagctgcccaagaagatccacctggcctgcatctggatggtctcgatcggcacg
ctgctgtcggcgtacttcatcctcgcggccaactcctggatgcagcaccccgtgggctac
cggatcaacgaggagaagggccgcgccgaactcaccgacttctggcaggtcctcacccag
aacaccaccctcaaccaggtcttccacagcttctcggcggccttcctcacgggcggcgcc
ttcatggtcggcatcgccgccttccacctgatgcgcaagaagcacatcccggtgatgcgg
acctcgctccggctcggcctggtgaccctggcggtcggcggcctgctcaccgcggtcagc
ggcgacaccctcggcaaggtcatgtacgagcagcagccgatgaagatggccgccgccgag
gccctgtgggacggcgagaagccggcacccttctcggtcttcgcctacggggacgtggac
aaggggcacaacaaggtcgccctggaggtccccgggctgctgtccttcctcgcgcacagc
gacttcgagtcctacgtgcccggcatcaacgacaccaacaaggccctccaggagcagttc
gggcccggtgactacaagcccatcgtccccgtcgcctactggggcttccggtggatgatc
ggcttcggcatggcgtccttctccctcggcctgctgggcctgtggctgacgcggaagcgg
ttcctgctgccaccggccctgcgcaccggggaggacgaggtcccgcacctggtgctgttg
aagaagccgctcggggcgaggctcacccggatgtactggctgctggcgctgtggacgatg
gcgttccccctgatcgccaactcctggggctggatcttcacggagatgggccggcagccc
tgggtggtctacggcgtgatgcagacccgggacgcggtctcccccggcgtctccacggcc
gaggtcatcatctcgatgtccgtcttcaccctgctgtacgccgtcctggccgtcatcgag
gtcaagctcctggcgaagtacgtgaaggccggaccgcccgagctgaccgaggccgacctc
aatccgcccacgaagatcggcggcgatctccgtgacgccgacaagccgatggccttctcg
tactag

DBGET integrated database retrieval system