KEGG   Streptomyces coelicolor: SCO3962Help
Entry
SCO3962           CDS       T00085                                 

Gene name
pheA, SCD78.29c
Definition
(RefSeq) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3962 (pheA)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     SCO3962 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 1099398
NCBI-ProteinID: NP_628146
Kitasato: SCO3962
UniProt: Q9ZBX0
Position
complement(4362335..4363267)
Genome map
AA seq 310 aa AA seqDB search
MPASYAYLGPEGTFTEVALRTLPETATRELVPYVSVQSALDAVRTGEAEAAFVPIENSVE
GGITTTLDELVAGQPLMIYREVLLSITFALLVRPGTKLSDIKTVTAHPAAQPQVRNWIKA
HLPDVAWESAASNADGARLVQEGRYDAAFAGEFAAERYGLEVLEADIHDAENAQTRFVLV
GRPARPAAPTGADKTSVVLWQRDDHPGGLRDLLGEFATRGINLMLLQSRPTGAGIGNYCF
CIDAEGHISDRRVADALMGLKRTCLQVRYLGSYPRAEVTPADVDALRPGTSDEAFVAAAD
WVARCQDGRF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagttacgcgtatctcggccctgaaggcaccttcaccgaagtcgccctgcgc
actctcccggagacggcgacccgggaactggtcccgtacgtctccgtgcagtccgcgctc
gacgcggtgcgcaccggcgaggccgaggccgcgttcgtgccgatcgagaactccgtcgag
ggcggcatcaccaccaccctcgacgagctggtcgccggccagccgctgatgatctaccgc
gaggtgctgctgtccatcaccttcgcgctgctggtccggcccggcaccaagctgtcggac
atcaagacggtcaccgcccacccggcggcgcagccccaggtccgcaactggatcaaggcg
cacctcccggacgtcgcctgggagtcggccgcctccaacgcggacggtgcccggctggtg
caggaggggcggtacgacgccgccttcgccggtgagttcgccgcggagcgctacggcctc
gaggtgctggaggccgacatccacgacgcggagaacgcccagacgcgcttcgtgctggtg
ggccgcccggcccggcccgcggcaccgaccggggcggacaagacgtccgtcgtactctgg
cagcgcgacgaccaccccggcggcctgcgcgatctgctgggcgagttcgccacccggggc
atcaacctgatgctgctgcaatcccggcccaccggtgcgggcatcggcaactactgcttc
tgcatcgacgccgaggggcacatctccgaccgacgggtggccgacgcgttgatgggcctg
aagcggacctgtctccaggtgcgctatctggggtcgtatccgcgtgcggaggtcacgccc
gccgatgtggacgcactgcgtccgggcacctcggacgaggcgttcgtggcagcggcggac
tgggtggcacgctgccaggacggccggttctga

DBGET integrated database retrieval system