KEGG   Streptomyces coelicolor: SCO4041Help
Entry
SCO4041           CDS       T00085                                 

Gene name
upp
Definition
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO4041 (upp)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     SCO4041 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran
Motif
Other DBs
NCBI-GeneID: 1099477
NCBI-ProteinID: NP_628223
Kitasato: SCO4041
UniProt: Q9AK76
Position
4435469..4436113
Genome map
AA seq 214 aa AA seqDB search
MVDMRLHVVDHPLVAHKLTTLRDQRTDSATFRRLADELVTLLAYEATRDVRTEQVDIHTP
VSRTTGVKLSHPRPLVVPILRAGLGMLDGMVRLLPTAEVGFLGMVRNEETLQASTYATRM
PDDLSGRQVYVLDPMLATGGTLVASIRELIKRGADDVTAVVLLAAPEGVELMERELAGTP
VTVVTASVDERLNEQGYIVPGLGDAGDRMYGAAE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtggtggacatgcgtctccacgtcgtcgaccaccccctggtcgcccacaagctcaccacg
ctgcgcgaccagcgcaccgactccgcgaccttccgccgtctcgccgacgagctggtcacc
ctgctcgcctacgaggccacgcgggacgtccgcaccgaacaggtcgacatccacacgccg
gtctcccggaccaccggcgtcaagctctcccacccgcgcccgctggtggtgccgatcctg
cgggccggtctcggcatgctcgacggcatggtccggctgctgccgaccgccgaggtgggc
ttcctcggcatggtgcgcaacgaggagacgctccaggcctccacgtacgccacgcgcatg
ccggacgacctgtccgggcgccaggtgtacgtcctcgaccccatgctggccaccggcggc
acgctggtcgcgtccatcagggagctgatcaagcgcggcgccgacgacgtgacggcggtg
gtgctgctcgccgcccccgagggtgtcgagctgatggagcgcgagctggccggcaccccg
gtgacggtcgtgacggcctcggtcgacgagcgtctcaacgagcagggctacatcgtcccg
ggcctcggcgacgcgggcgaccgcatgtacggagcggccgaatag

DBGET integrated database retrieval system