KEGG   Streptomyces coelicolor: SCO4071Help
Entry
SCO4071           CDS       T00085                                 

Gene name
hemH
Definition
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4071 (hemH)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     SCO4071 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 1099508
NCBI-ProteinID: NP_628252
Kitasato: SCO4071
UniProt: Q9RKL1
Position
4464986..4465885
Genome map
AA seq 299 aa AA seqDB search
MSGFVEKPEPIQVPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRV
LTQLSLWWFDQLADLAPNHVLSTELPPGAPADWEGRALVCKSLRMVPVECVARGYLTGSG
LAEYDETRTVCGLALPEGLVDGSELPAPIFTPATKAEVGEHDENVSYEEVARQVGADTAA
ALRQATLAVYSRARDIARERGIVLADTKFEFGFDGDDLVLADEVLTPDSSRFWPADRWQP
GRAQPSYDKQFVRDWLTSAESGWDRKSEQPPPPLPQQVVDATRAKYVEAYELLTGQSWS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggattcgttgaaaagcccgagccgatccaggttccgggtctggtgcatctgcac
accggcaaggtgcgcgagctgtaccggaacgaggcgggcgacctcgtgatggtcgccagc
gaccgcatctccgcctacgactgggtgctgccgaccgagatccccgacaagggccgggtc
ctcacccagctctccctgtggtggttcgaccagctcgccgacctggcccccaaccacgtc
ctgagcaccgagctgccccccggcgcccccgccgactgggagggccgcgccctggtctgc
aagtcgctgcggatggtccccgtggagtgcgtggcccgcggctacctcaccggctccggc
ctggcggagtacgacgagacccgcaccgtgtgcggcctcgccctgcccgagggactcgtc
gacggctcggagctgcccgccccgatcttcaccccggccaccaaggccgaggtcggcgag
cacgacgagaacgtctcctacgaggaggtcgcccgccaggtcggcgcggacaccgcggcc
gccctgcgccaggccaccctcgccgtctactcccgcgcccgggacatcgcccgcgagcgc
ggcatcgtcctcgcggacaccaagttcgagttcggcttcgacggggacgacctggtcctc
gccgacgaggtcctcaccccggactcctcccgcttctggccggccgaccggtggcagccg
ggccgcgcgcagccgtcgtacgacaagcagttcgtgcgggactggctgacctcggccgag
tccggctgggaccggaagagcgagcagcccccgccgccgctgccgcagcaggtcgtggac
gccacccgcgccaagtacgtggaggcctacgagctgctgaccggccagagctggtcgtag

DBGET integrated database retrieval system