KEGG   Streptomyces coelicolor: SCO4078Help
Entry
SCO4078           CDS       T00085                                 

Gene name
purQ, SCD25.14
Definition
(RefSeq) phosphoribosylformylglycinamidine synthase I
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4078 (purQ)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     SCO4078 (purQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_5 GATase_3 DJ-1_PfpI GATase Peptidase_C26 SNO DUF2920
Motif
Other DBs
NCBI-GeneID: 1099515
NCBI-ProteinID: NP_628259
Kitasato: SCO4078
UniProt: Q9RKK6
Position
4471198..4471878
Genome map
AA seq 226 aa AA seqDB search
MTARIGVVTFPGSLDDRDTQRAIRVAGAEPVALWHKDKDLKQVDAVVLCGGFSYGDYLRA
GAIARFSPVMDTVIDQAKAGLPVLGICNGFQILTEAHLLPGGMLGNDHLHFICRDQKLRV
ENADTSWTSDYTAGQEIHIPLKNMDGRYVADRRTLDELEAEGRVAFRYLDMNPNGSLNDI
AGITNAAGNVVGLMPHPEHAVESLIGTGRTDGLPFFTSILKKLVNA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgtattggcgtcgtcactttccccggcagtctcgacgaccgggacacgcag
cgcgcgatccgtgtcgccggtgccgaacccgtcgccctctggcacaaggacaaggacctc
aagcaggtcgacgccgtggtgctgtgcggcggtttctcgtacggcgattatctgcgcgcc
ggcgccatcgcgcgcttctcgccggtgatggacaccgtcatcgaccaggcgaaggccggt
ctgccggtgctgggcatctgcaacggcttccagatcctcaccgaggcccacctgctgccc
ggcggcatgctgggcaacgaccacctgcacttcatctgccgcgaccagaagctgcgggtg
gagaacgcggacacctcctggaccagtgactacaccgccggtcaggagatccacatcccg
ctgaagaacatggacggccgctacgtcgccgaccggcgcacgctggacgagctggaggcc
gagggacgggtggccttccgctacctggacatgaaccccaacggctcgctcaacgacatc
gccggcatcaccaacgccgccgggaacgtcgtcggcctcatgccgcaccccgagcacgcc
gtcgagtcgctgatcggtacgggccgtaccgacggcctgccgttcttcacctcgatcctc
aagaagctggtcaacgcatga

DBGET integrated database retrieval system