KEGG   Streptomyces coelicolor: SCO4086Help
Entry
SCO4086           CDS       T00085                                 

Gene name
purF, SCD25.22
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4086 (purF)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4086 (purF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sco01002]
    SCO4086 (purF)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     SCO4086 (purF)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO4086 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_2 GATase_4 PRTase_2 DUF3700
Motif
Other DBs
NCBI-GeneID: 1099523
NCBI-ProteinID: NP_628267
Kitasato: SCO4086
UniProt: Q7AKK3
Position
4479261..4480853
Genome map
AA seq 530 aa AA seqDB search
MIHEWSRIPNSDQWSISPTLEGVPRGDGRLNHDLLPGEKGPQDACGVFGVWAPGEEVAKL
TYFGLYALQHRGQESAGIAVSNGSQILVFKDMGLVSQVFDETSLGSLQGHIAVGHARYST
TGASVWENAQPTFRATAQGSIALGHNGNLVNTAQLAGLVADLPKQDGRSTRVAATNDTDL
ITALLAGQVDDDGKPLTVEEAAGKVLPQVRGAFSLVFMDEHTLYAARDPQGIRPLVLGRL
ERGWVVASESAALDICGASYVREIEPGEFVAIDENGLRTSRFAEAKPKGCVFEYVYLARP
DTDIAGRNVYLSRVEMGRKLAKEAPAEADLVIATPESGTPAAIGYAEASGIPFGNGLVKN
AYVGRTFIQPSQTIRQLGIRLKLNPLKEVIKGKRLVVVDDSIVRGNTQRALVRMLREAGA
AEIHIRISSPPVKWPCFFGIDFATRAELIANGMSVEEIGTSMGADSLAYISIDGMIEATT
IAKPNLCRACFDGEYPMELPDPELLGKQLLETELAAGPAGTAAADAIRRP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgatccatgagtggtcccgtatccccaattcggaccagtggtcgatctcgcctacactc
gaaggcgtgccacgtggtgacggtcgactcaatcacgatctgcttcccggcgagaagggc
ccccaggacgcttgcggcgtcttcggtgtctgggctccgggcgaagaggtcgcaaagctc
acgtacttcgggctgtacgccctccagcatcggggccaggaatccgcgggaatcgcggtc
agcaacggctcccagatcctcgtcttcaaggacatgggcctggtgtcccaggtcttcgac
gagacctcgctcggttcgctccagggtcacatcgcggtcggtcacgcccgctactcgacc
accggtgcctccgtgtgggagaacgcccagccgacgttccgtgccaccgcgcagggttcc
atcgcgctcgggcacaacggcaacctcgtcaacaccgcccagctcgccgggctggtggcc
gacctgccgaagcaggacggccgctccacccgggtcgcggcgaccaacgacaccgacctg
atcaccgcgctgctcgcgggccaggtcgacgacgacggcaagccgctgaccgtcgaggag
gcggccggcaaggtgctgccccaggtgcgcggcgccttctccctcgtcttcatggacgag
cacaccctctacgccgcccgcgacccgcagggcatccgcccgctggtcctcggccgcctg
gagcgcggctgggtggtcgcctccgagtccgccgccctggacatctgcggcgcctcctac
gtccgggagatcgagccgggcgagttcgtcgccatcgacgagaacggcctgcggacatcg
cgattcgcagaagcgaagcccaagggctgtgtcttcgagtacgtgtacctggcccgcccg
gacaccgacatcgccggccgcaacgtctacctctcgcgtgtcgagatgggccgcaagctg
gcgaaggaggcccccgcggaggccgatctcgtcatagcgaccccggaatccggcaccccc
gccgcgatcggctacgccgaggcctccggcatccccttcggcaacggcctggtgaagaac
gcctatgtcggccggaccttcatccagccctcacagaccatccgccagctgggcatccgc
ctgaagctgaatcccctgaaggaagtcatcaagggcaagcggctggtcgtcgtcgacgac
tccatcgtccgcggcaacacccagcgggccctggtccgcatgctccgcgaggcgggcgcc
gccgagatccacatccggatctcgtccccgcccgtgaagtggccctgcttcttcggcatc
gacttcgccacccgcgccgagctgatcgccaacggcatgagcgtcgaggagatcggcacc
tcgatgggcgccgactccctggcgtacatctccatcgacggcatgatcgaggcgaccacc
atcgccaagcccaacctgtgccgcgcctgcttcgacggcgagtacccgatggagcttccc
gaccccgagctgctcggcaagcagctcctggagaccgagctggccgccgggcccgccggt
acggccgccgccgacgccatccgtcgcccgtag

DBGET integrated database retrieval system