KEGG   Streptomyces coelicolor: SCO4089Help
Entry
SCO4089           CDS       T00085                                 

Gene name
SCD25.25c, vdh
Definition
(RefSeq) valine dehydrogenase
  KO
K00271  valine dehydrogenase (NAD+) [EC:1.4.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
sco00280  Valine, leucine and isoleucine degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4089 (SCD25.25c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.23  valine dehydrogenase (NAD+)
     SCO4089 (SCD25.25c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog NAD_binding_7 2-Hacid_dh_C NAD_binding_2 TrkA_N F420_oxidored Shikimate_DH 3HCDH_N Epimerase
Motif
Other DBs
NCBI-GeneID: 1099526
NCBI-ProteinID: NP_628270
Kitasato: SCO4089
UniProt: Q06539
Position
complement(4482654..4483748)
Genome map
AA seq 364 aa AA seqDB search
MTDVNGAPADVLHTLFHSDQGGHEQVVLCQDRASGLKAVIALHSTALGPALGGTRFYPYA
SEAEAVADALNLARGMSYKNAMAGLDHGGGKAVIIGDPEQIKSEELLLAYGRFVASLGGR
YVTACDVGTYVADMDVVARECRWTTGRSPENGGAGDSSVLTSFGVYQGMRAAAQHLWGDP
TLRDRTVGIAGVGKVGHHLVEHLLAEGAHVVVTDVRKDVVRGITERHPSVVAVADTDALI
RVENLDIYAPCALGGALNDDTVPVLTAKVVCGAANNQLAHPGVEKDLADRGILYAPDYVV
NAGGVIQVADELHGFDFDRCKAKASKIYDTTLAIFARAKEDGIPPAAAADRIAEQRMAEA
RPRP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgtaaacggcgcacctgctgatgtactgcacaccctgttccactcggatcag
gggggacatgagcaagtcgtgctctgccaggaccgtgccagcggcctcaaggccgtgatc
gccctccactccaccgccctgggcccggcgctcggcggtacccgcttctacccgtacgcg
agcgaggcggaggccgtcgccgacgcgctgaacctcgcccgcgggatgtcgtacaagaac
gccatggccggtctggaccacggtggcggcaaggccgtgatcatcggcgatccggagcag
atcaagagcgaggagctgctcctcgcctacggccggttcgtcgcctcgctgggcggccgc
tacgtcaccgcgtgcgacgtcggcacctacgtcgccgacatggacgtcgtggcccgcgag
tgccgctggacgaccgggcgttccccggagaacggcggcgcgggcgactcctccgtgctc
acctccttcggcgtctaccagggcatgcgggccgccgcccagcacctgtggggcgacccg
acgctgcgcgaccgcaccgtcggcatcgcgggcgtcggcaaggtcggccaccacctggtc
gagcacctgctcgccgagggcgcccacgtcgtcgtcacggacgtgcgcaaggacgtggtg
cgcgggatcacggagcggcacccgtcggtggtcgccgtcgccgacaccgacgcgctgatc
cgggtggagaacctggacatctacgcgccctgcgcgctcggcggcgcgctgaacgacgac
accgtgccggtgctgaccgccaaggtggtgtgcggcgcggccaacaaccagctcgcccac
ccgggcgtcgagaaggacctcgccgaccgcgggatcctctacgcgccggactatgtggtg
aacgccggcggtgtcatccaggtcgccgacgagctgcacgggttcgacttcgaccggtgc
aaggcgaaggcctcgaagatctacgacaccacgctggccatattcgcacgtgcgaaggag
gacggtattccgccggccgcggcggccgaccggatcgccgagcagcggatggcggaggcc
cgtccccggccgtga

DBGET integrated database retrieval system