KEGG   Streptomyces coelicolor: SCO4138Help
Entry
SCO4138           CDS       T00085                                 

Gene name
pitH, SCD84.05
Definition
(RefSeq) phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SCO4138 (pitH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-GeneID: 1099578
NCBI-ProteinID: NP_628315
Kitasato: SCO4138
UniProt: Q9KZW3
Position
4552519..4553517
Genome map
AA seq 332 aa AA seqDB search
MDTFALVVTIGVALFFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFMGSG
VAKTVSEGVIETPEGSKGMGILFAALVGAIVWNLITWYFGLPSSSSHALFGGMVGAALAG
STTVYWHGVVDKIVIPMFVSPVIGLLAGYLVMTAIMWIFRRANPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVIADVEDYGDPIPVWVKLACALMLSLGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGASIMFGSAFIFHAPISTTHVITSAIMGVGATRRVNAVRWG
VAKNIIMGWFITMPAAAVVAAVSFWIVNLAVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacacctttgctctggtcgtgaccatcggggtcgcgctcttcttcacgtacaccaac
ggtttccacgattcggccaacgcgatcgccacctccgtgtcgacgcgcgcgctgacgccg
cgggcggcgctcgccatggccgcggtgatgaacctggccggcgcgttcatgggatccggg
gtcgccaagaccgtcagcgagggggtcatcgagacccccgagggttcgaaggggatgggg
atcctcttcgcggcgctcgtgggcgccatcgtctggaacctcatcacctggtacttcggg
ctgccctcgtcctcgtcgcacgcgctgttcggcggcatggtcggcgccgcgctggccggg
agtacgaccgtgtactggcacggggtcgtcgacaagatcgtcatccccatgttcgtgtcg
ccggtgatcggcctgctcgccggttacctggtgatgaccgcgatcatgtggatcttccgg
cgggccaacccgcacaaggcgaagcgcggcttccgcatcgcgcagaccgtgtcggcggcg
ggcatggcgctggggcacggcctgcaggacgcgcagaagacgatgggcatcgtggtgatg
gcactggtcatcgccgacgtcgaggactacggcgacccgatcccggtgtgggtgaagctc
gcctgtgcgctgatgctgtcgctcgggacgtacgcgggcggctggcggatcatgcggacg
ctggggcggaagatcatcgagctggacccgccccaggggttcgccgcggagacgacgggc
gcgtcgatcatgttcggttcggcgttcatcttccacgcgccgatctccacgacgcacgtg
atcacctcggcgatcatgggcgtgggggcgacgaggcgggtcaacgcggtgcggtggggg
gtcgcgaagaacatcatcatggggtggttcatcacgatgcccgccgccgcggtggtggcc
gcggtgtcgttctggatcgtgaacctggcggtcctgtag

DBGET integrated database retrieval system