KEGG   Streptomyces coelicolor: SCO4209Help
Entry
SCO4209           CDS       T00085                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00260  Glycine, serine and threonine metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00002  Glycolysis, core module involving three-carbon compounds
sco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4209 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO4209 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4209 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sco04131]
    SCO4209 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO4209 (gpmA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCO4209 (gpmA)
Membrane trafficking [BR:sco04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SCO4209 (gpmA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCO4209 (gpmA)
  Exosomal proteins of melanoma cells
   SCO4209 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4015
Motif
Other DBs
NCBI-GeneID: 1099649
NCBI-ProteinID: NP_628384
Kitasato: SCO4209
UniProt: P33158
Position
4618020..4618781
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNEKNLFTGWVDVNLTPKGEKEATRGGELLKDAGLLPDVVHTS
VQKRAIRTAQLALEAADRHWIPVHRHWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPALDRDAEYSQFSDPRYAMLPPELRPQTECLKDVVGRMLPYWFDAIVPDLLTGRT
VLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLSYELNAEFKPLNPGGTYLDPDAAA
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgagtggaacgag
aagaacctgttcaccggctgggtggacgtcaacctcaccccgaagggcgagaaggaggcg
acgcgcggcggcgagctgctcaaggacgccggcctgctgcccgacgtggtccacacgtcc
gtccagaagcgcgcgatccgcacggcccagctcgcgctggaggccgccgaccgccactgg
atcccggtccaccgccactggcgcctgaacgagcgccactacggcgccctccagggcaag
gacaaggcccagaccctcgccgagttcggcgaggagcagttcatgctgtggcgccgctcc
tacgacaccccgccgcccgcgctggaccgcgacgccgagtactcccagttctccgacccg
cgttacgcgatgctcccgccggagctgcgcccgcagacggagtgcctgaaggacgtcgtc
ggccggatgctcccgtactggttcgacgcgatcgtccccgacctcctcaccggccgcacg
gtcctggtggcggcgcacggcaactccctccgcgccctcgtcaagcacctcgacggcatc
tccgacgccgacatcgcgggcctgaacatcccgacgggcatcccgctctcgtacgaactc
aacgccgagttcaagcccctgaacccgggcggcacgtacctcgacccggacgcggccgcg
gcggcgatcgaggccgtgaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system