KEGG   Streptomyces coelicolor: SCO4288Help
Entry
SCO4288           CDS       T00085                                 

Gene name
SCD95A.21
Definition
(RefSeq) phosphatase
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00500  Starch and sucrose metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO4288 (SCD95A.21)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     SCO4288 (SCD95A.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trehalose_PPase Hydrolase_3 NTP_transf_8
Motif
Other DBs
NCBI-GeneID: 1099728
NCBI-ProteinID: NP_628460
Kitasato: SCO4288
UniProt: Q9KXV3
Position
4703578..4704450
Genome map
AA seq 290 aa AA seqDB search
MGSHQDSTRDDSPQPLPTPATAAGREGLDALLADPGRAVVALDFDGTLAPIVPDPDRARA
HPDAVPALAALAPKVASIAVITGRPAEVAVHHGGFADVPGLDRLVVLGHYGAERWDAATG
TLTTPEPHPGVAAVRAELPALLERSGPAARGTWTEDKGHAVAVHTRRAPDPQAAFDALRA
PLTGLASRHGLIVEPGRMVLELRPPGMDKGAALRSYVHSLDAASVLFAGDDLGDLPAYAA
VDVLRTEGTPGLLVCSGSDEVTELRKRADVEVPGPAGVVALLAALAHRLA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccaccaggactccacccgagacgactccccacagcccctgccgacgcccgcg
acggcggccggacgcgaagggctcgacgccctcctcgccgaccccggccgcgcggtggtc
gcgctcgacttcgacggcacgctcgccccgatcgtgcccgaccccgaccgggcccgtgcc
cacccggacgccgtaccggcgctcgcggccctggccccgaaggtcgcctcgatcgcggtg
atcaccgggcgccccgccgaggtcgccgtccaccacggcggcttcgcggacgtccccggc
ctcgaccgcctcgtggtcctcggccactacggtgccgagcgctgggacgccgccaccggc
accctgaccacgccggaaccgcaccccggcgtcgccgccgtccgcgccgagctgccggcc
ctgctggagcggtccggtccggcggcgcggggcacctggacggaggacaagggccacgcg
gtcgccgtccacacccgccgcgcccccgacccgcaggccgccttcgacgccctgcgcgcc
ccgctcaccggcctggcctcccggcacggcctgatcgtcgagccgggccgcatggtcctg
gaactgcgcccacccggcatggacaagggcgcggcgctgcggtcgtacgtccactccctc
gacgccgcctccgtcctcttcgccggcgacgacctcggggacctcccggcctacgcggcc
gtcgacgtcctgcgcaccgagggcactccggggctgctggtctgcagcggcagcgacgag
gtgacggaactgaggaagcgcgcggacgtcgaggtgcccggccccgccggagtggtggcc
ctgctggcggccctcgcgcaccggctggcctga

DBGET integrated database retrieval system