KEGG   Streptomyces coelicolor: SCO4293Help
Entry
SCO4293           CDS       T00085                                 

Gene name
SCD95A.26
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00750  Vitamin B6 metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
Module
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4293 (SCD95A.26)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCO4293 (SCD95A.26)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCO4293 (SCD95A.26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DNA_RNApol_7kD
Motif
Other DBs
NCBI-GeneID: 1099733
NCBI-ProteinID: NP_628465
Kitasato: SCO4293
UniProt: Q9KXU8
Position
4708607..4709893
Genome map
AA seq 428 aa AA seqDB search
MQTAETSTNPTDAAVDLGPATALSCRECGHRVPLGPVFACEECFGPLEIAYDFSDYDAEE
LRKRIEAGPANIWRYAPLLPVPADVATKPNINPGWTKLVQADNLARELGVTGGLYVKDDS
GNPTHSFKDRVVAQAIEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPHDLEQ
GKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYAEGSKTLAYE
ICEQLGWRLPDQIVVPIASGSQLTKIDKGLKELIELGLVEDRPYKIFGAQAEGCSPVSTA
YKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEQVVDAIKLLART
EGIFAETAGGVTVGVTRKLIENGVLDPSLTTVVLNTGDGLKTLDAVAGTGLTATIRPNLD
SFREAGLA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgcagactgccgaaacctccacgaaccccaccgacgccgccgtcgacctcggccccgcc
accgcgctgagctgccgggagtgcggccacagggttccgctcggaccggtcttcgcctgc
gaagagtgtttcggccccctcgagatcgcctacgacttctcggactacgacgccgaagag
ctgcgcaagcggatcgaagccggccccgcgaacatctggcgctacgcccccctgctgccc
gtcccggccgacgtcgcgaccaagccgaacatcaaccccggctggaccaagctcgtccag
gccgacaacctcgcccgcgagctgggcgtcaccggcggcctgtacgtcaaggacgactcc
ggcaaccccacgcactccttcaaggaccgcgtcgtcgcccaggccatcgaggccgcccgc
gccttcggcttcaccaccctgtcctgctcctccaccggcaacctcgccggtgccgtcggc
gccgccgccgcccgggccggcttccgctcctgcgtgttcatcccgcacgacctggagcag
ggcaaggtcgtcatggccgccgtctacggcggtgagctggtcggcatcgagggcaactac
gacgacgtgaaccgcttctgctccgagctgatcggcgaccctgccggcgagggctggggc
ttcgtcaacgtcaacctgcggccgtactacgccgagggttccaagaccctcgcctacgag
atctgcgagcagctcggctggcggctgcccgaccagatcgtcgtgccgatcgcctccggc
tcccagctgacgaagatcgacaaggggctcaaggagctgatcgagctgggtctggtcgag
gaccggccgtacaagatcttcggcgcgcaggccgagggctgctcgccggtctccacggcg
tacaaggccgggcacgacgtggtccgcccgcagaagccgaacaccatcgccaagtcgctg
gccatcggcaacccggccgacggcccctacgtcctcgacatcgcccgccgcaccggcggc
gccgtggaggacgtgaccgacgagcaggtcgtggacgcgatcaagctgctcgcccgtacc
gagggcatcttcgcggagacggcgggcggcgtgacggtcggcgtcaccaggaagctgatc
gagaacggcgtcctcgacccgtcgctcaccaccgtcgtcctgaacaccggcgacggcctg
aagaccctcgacgcggtggccggcaccggtctcaccgccaccatccgccccaacctggac
tccttccgagaggctggcctcgcatga

DBGET integrated database retrieval system