KEGG   Streptomyces coelicolor: SCO4366Help
Entry
SCO4366           CDS       T00085                                 

Gene name
SCD19.21c
Definition
(RefSeq) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00680  Methane metabolism
sco00750  Vitamin B6 metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SCO4366 (SCD19.21c)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4366 (SCD19.21c)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCO4366 (SCD19.21c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO4366 (SCD19.21c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     SCO4366 (SCD19.21c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class V
   SCO4366 (SCD19.21c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1099806
NCBI-ProteinID: NP_628536
Kitasato: SCO4366
UniProt: Q9F2Y1
Position
complement(4778229..4779320)
Genome map
AA seq 363 aa AA seqDB search
MKPADGRFGAGPSKVRVEALDALAATGTSLLGTSHRQAPVKNLVGKVREGIRELFRLPDG
YEVILGNGGSTAFWDVATHGLIENKSQHLSFGEFSSKFAKAAKLAPWLAEPTVVAADPGT
HPEARAEAGVDVYGLTHNETSTGVAMPIRRVAGADEGALVLVDATSGAGGLPVDISETDV
YYFAPQKSFASDGGLWIGVFSPAAIERAERVHASGRHVPEFFSLPTAIDNSRKNQTYNTP
ALATLFLLGEQLDWMNGQGGLDFTTARTKDSSSRLYTWADESKYATPFVSDPTKRSQVIG
TIDFSDDIDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFPAIDPADVEALTKCVDHVI
EKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcggacggtcgtttcggcgcgggtccctccaaggtgcgggtggaggcgctg
gacgccctggccgccaccggtacgtccctgctcggcacctcccaccgccaggcgcccgtc
aagaacctggtcggcaaggtccgtgagggcatccgcgagctgttccggctccccgacggc
tacgaggtgatcctcggcaacggcggctccacggcgttctgggacgtcgcgacccacggc
ctgatcgagaacaagtcgcagcacctgagcttcggcgagttctcctccaagttcgccaag
gccgccaagctcgccccgtggctggccgaaccgaccgtcgtcgccgccgaccccggcacc
caccccgaggcgcgcgccgaggccggcgtggacgtgtacggcctcacgcacaacgagacc
tccaccggtgtcgccatgcccatcaggcgcgtggccggtgccgacgagggcgccctcgtc
ctggtcgacgcgacgtcgggggcgggcggccttccggtcgacatctcggagaccgacgtc
tactacttcgccccgcagaagtccttcgcctccgacggcggcctgtggatcggcgtgttc
tccccggccgcgatcgagcgcgccgagcgcgtgcacgcgtccggccgccatgtcccggag
ttcttctcgctgccgacggcgatcgacaactcccgcaagaaccagacgtacaacaccccg
gcgctggccaccctgttcctcctcggcgagcagctggactggatgaacggccagggcggc
ctggacttcaccacggcccgcaccaaggactcctcgtcccgcctgtacacgtgggccgac
gagtccaagtacgccaccccgttcgtctcggacccgaccaagcgctcgcaggtcatcggc
acgatcgacttctccgacgacatcgacgccgccgccgtcgccaaggtgctgcgcgccaac
ggcatcgtcgacaccgagccgtaccgcaagctcggccgcaaccagctgcgcgtggcgatg
ttcccggcgatcgacccggcggacgtcgaggcgctgacgaagtgcgtggaccacgtcatc
gagaagctgtag

DBGET integrated database retrieval system