KEGG   Streptomyces coelicolor: SCO4388Help
Entry
SCO4388           CDS       T00085                                 

Gene name
SCD10.20
Definition
(RefSeq) citrate synthase 2
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sco_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO4388 (SCD10.20)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4388 (SCD10.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SCO4388 (SCD10.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt DUF3416
Motif
Other DBs
NCBI-GeneID: 1099828
NCBI-ProteinID: NP_628557
Kitasato: SCO4388
UniProt: Q9K3V6
Position
4804464..4805564
Genome map
AA seq 366 aa AA seqDB search
MSDFVPGLEGVVAFETEIAEPDKEGGALRYRGVDIEDLVGHVSFGNVWGLLVDGAFNPGL
PPAEPFPIPVHSGDIRVDVQSALAMLAPAWGLKPLLDIDAAQARDDLARAAVMALSYVAQ
SARGQSLPMVPQREIDKAQSVVERFMIRWRGEPDPKHVAAVDAYWTSAAEHGMNASTFTA
RVIASTGADVAAALSGAVGAMSGPLHGGAPSRVLHMIEEIERTGDAEAYVKKTLDAGERL
MGFGHRVYRAEDPRARVLRRTARELGAPRYEVAEALEKAALAELHARRPDRVLATNVEFW
AAIMLDFAEVPAPMFTSMFTCARTAGWSAHILEQKRTGRLVRPSARYTGPGTRDPREIEG
YADIAG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacttcgtacccgggctagagggagtcgtcgcgttcgagacggagatcgccgaa
cccgacaaggagggcggcgcccttcgctaccgcggcgtcgacatcgaggacctggtcggg
cacgtctccttcggcaacgtctggggcctgctcgtcgacggggccttcaaccccggcctg
ccgcccgccgagcccttccccatccccgtgcactccggcgacatcagggtcgacgtccag
tccgccctcgccatgctcgcccccgcctggggcctcaaacccctgctggacatcgacgcc
gcccaggcccgcgacgacctcgcccgggccgccgtcatggccctgtcctacgtcgcccag
tccgcgcgcggccagagcctgcccatggtcccgcagcgcgagatcgacaaggcccagtcc
gtggtcgaacggttcatgatccgctggcgcggcgagcccgaccccaagcacgtcgccgcc
gtcgacgcctactggacctccgcggccgagcacggcatgaacgcctccaccttcaccgcc
cgcgtcatcgcctccaccggcgcggacgtggccgccgccctctccggggccgtgggcgcc
atgtccggcccgctgcacggcggcgccccctcgcgcgtcctgcacatgatcgaggagatc
gagcgcaccggcgacgccgaggcctacgtcaagaagaccctcgacgcgggcgagcgcctc
atgggcttcggccaccgcgtctaccgcgccgaggacccgcgcgcccgggtcctgcgccgc
accgcccgcgaactgggcgccccgcgctacgaggtcgccgaggccctggagaaggccgcc
ctggccgagctgcacgcccgccgccccgaccgggtgctggccaccaacgtcgagttctgg
gccgccatcatgctggacttcgccgaggtgccggcccccatgttcacctcgatgttcacc
tgcgcccgcaccgcgggctggtccgcgcacatcctggaacagaagcgcaccggccgcctg
gtccgcccctccgcccgctacacggggccgggcacccgcgacccgcgcgagatcgagggc
tacgccgacatcgcgggctga

DBGET integrated database retrieval system