KEGG   Streptomyces coelicolor: SCO4562Help
Entry
SCO4562           CDS       T00085                                 

Gene name
nuoA, SCD16A.21c
Definition
(RefSeq) NADH dehydrogenase subunit A
  KO
K00330  NADH-quinone oxidoreductase subunit A [EC:7.1.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00190  Oxidative phosphorylation
sco01100  Metabolic pathways
Module
sco_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCO4562 (nuoA)
Enzymes [BR:sco01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     SCO4562 (nuoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q4 DUF5373
Motif
Other DBs
NCBI-GeneID: 1100002
NCBI-ProteinID: NP_628724
Kitasato: SCO4562
UniProt: Q9XAQ4
Position
4980274..4980633
Genome map
AA seq 119 aa AA seqDB search
MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK
YYLTAMLFIIFDIEIVFLYPWAVTFDALGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgtatgcgcccatcctcgtactgggagccctcggggcaggctttgcgatcttc
tccgtggtgatggccacgctgatcggtccgaagcggtacaaccgggcgaagctcgaggcc
tacgagtgcggcatcgagccgacccccacgccggccggcggcgggcgcttccccatcaag
tactacctgacggcgatgctcttcatcatcttcgatatcgagatcgtcttcctctacccc
tgggccgtcaccttcgacgccctggggattttcgggctcgtggagatgctgctcttcgtg
ctcaccgtcttcgtcgcgtacgcgtacgtatggcggcgcggcggcctggaatgggactga

DBGET integrated database retrieval system