KEGG   Streptomyces coelicolor: SCO4594Help
Entry
SCO4594           CDS       T00085                                 

Gene name
SCD20.12c
Definition
(RefSeq) 2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4594 (SCD20.12c)
   00020 Citrate cycle (TCA cycle)
    SCO4594 (SCD20.12c)
   00620 Pyruvate metabolism
    SCO4594 (SCD20.12c)
   00650 Butanoate metabolism
    SCO4594 (SCD20.12c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     SCO4594 (SCD20.12c)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     SCO4594 (SCD20.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 1100034
NCBI-ProteinID: NP_628756
Kitasato: SCO4594
UniProt: Q9F2W7
Position
complement(5016376..5017434)
Genome map
AA seq 352 aa AA seqDB search
MPDAGALLPLVPKAGGKQSMKDFKSDQEVRWCPGCGDYAILAAVQGFMPQLGLARENIVF
VSGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLATSRRDLSVWVVTGDGDALSIGGNHLI
HALRRNVNLKILLFNNRIYGLTKGQYSPTSEVGKITKSTPMGSLDAPFNPISLALGAEAS
FVARTVDSDRKHLTEVLRQAAEHPGTALIEIYQNCNIFNDGAFDALKDKQQAEEAVIRLE
HGQPIRFGTDNTKGVLRNPHTGDLDIVTVTADNEADILVHDAHATSPTTAFALSRLADPD
TLHHTPIGVLRSVERPVYDTLMSEQLDTAVETDGKGDLAALLAGNDTWTVVG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgcgggcgcactgctccccctcgtccccaaggccgggggcaagcagtccatg
aaggacttcaagtccgaccaggaagtgcgctggtgccccggctgcggcgactacgccatc
ctcgccgccgtgcagggcttcatgccccagctcggcctcgcccgcgagaacatcgtcttc
gtctccggcatcggctgctcctcccgcttcccgtactacatgaacacctacgggatgcac
tccatccacggccgcgcccccgccatcgccaccggcctcgccacctcccgccgcgacctg
tcggtgtgggtcgtcaccggggacggcgacgcgctctccatcggcggcaaccacctcatc
cacgccctgcgccgcaacgtcaacctcaagatcctgctgttcaacaaccggatctacggc
ctcaccaaaggccagtactcccccacctccgaggtcgggaagatcaccaagtcgacaccg
atgggctccctcgacgcgcccttcaaccccatctccctggccctcggcgcggaggcgtcc
ttcgtcgcccggaccgtcgactccgaccgcaaacacctcaccgaggtactgcgccaggcc
gccgaacaccccggcaccgccctgatcgagatctaccagaactgcaacatcttcaacgac
ggcgccttcgacgccctcaaggacaaacagcaggccgaagaagcagtgatccgcctggaa
cacgggcagccgatccgtttcggcaccgacaacaccaagggcgtcctacgcaacccgcac
accggagacctggacatcgtcaccgtcaccgcggacaacgaagcagacatcctcgtccac
gacgcccacgccacctcccccaccacggccttcgcactctcccgcctcgccgaccccgac
accctgcaccacacccccatcggcgtcctgcgctccgtcgaacgccccgtctacgacacc
ctcatgtccgaacagctcgacaccgccgtcgaaacagacggcaagggcgacctcgccgcg
ttgctggccggcaacgacacctggacggtcgtcggctga

DBGET integrated database retrieval system