KEGG   Streptomyces coelicolor: SCO4645Help
Entry
SCO4645           CDS       T00085                                 

Gene name
aspC, SCD82.16c
Definition
(RefSeq) aspartate aminotransferase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 1100086
NCBI-ProteinID: NP_628806
Kitasato: SCO4645
UniProt: Q9L0L5
Position
complement(5069749..5070975)
Genome map
AA seq 408 aa AA seqDB search
MSAAIPPTERRVSARVGAISESATLAVDAKAKALKAAGRPVIGFGAGEPDFPTPDYIVEA
AVEACKNPKFHRYTPAGGLPELKAAIAAKTLRDSGYEVDPSQILVTNGGKQAIYEAFAAI
LDPGDEVIVPAPYWTTYPESIRLAGGVPVEVVADETTGYRVTVEQLEAARTEKTKVVLFV
SPSNPTGAVYGEAETEAIGRWAVEHGLWVLTDEIYEHLVYGDAVSVSLPALLPELRDKCI
VVNGVAKTYAMTGWRVGWVIGPKDVVKAATNLQSHATSNVANVSQAAALAAVSGNLDAVA
KMREAFDRRRQTIVRMLNEIDGVLCPEPEGAFYAYPSVKALLGKEIRGKRPQDSVELAAL
ILEEAEVAVVPGEAFGTPGYLRLSYALGDEDLVEGVSRIQKLLAEARD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcaatccctcccaccgagcgccgggtctccgcccgagtcggcgcgatctcc
gagtccgcgaccctcgccgtggacgccaaggccaaggccctcaaggccgccggacgtccc
gtgatcggcttcggcgcgggtgagcccgacttcccgacgccggactacatcgtcgaggcc
gccgtcgaggcgtgcaagaacccgaagttccaccgctacacgccggccggcgggctgccc
gagctgaaggccgccatcgccgcgaagacgctgcgcgactccggctacgaggtcgacccg
tcgcagatcctcgtcaccaacggcggcaagcaggccatctacgaggcgttcgccgcgatc
ctcgacccgggcgacgaggtcatcgtcccggcgccgtactggacgacgtacccggagtcg
atccggctggccggcggtgtgcccgtcgaggtcgtcgccgacgagacgaccggctaccgg
gtgacggtggagcagctggaggcggcgcgcaccgagaagaccaaggtcgtcctgttcgtg
tcgccgtcgaacccgacgggggcggtgtacggcgaggccgagaccgaggccatcggccgc
tgggccgtcgagcacgggctgtgggtgctgaccgacgagatctacgagcacctggtgtac
ggcgacgccgtctccgtgtccctgccggcgctgctgcccgagctgcgcgacaagtgcatc
gtggtcaacggcgtggcgaagacgtacgcgatgaccggctggcgggtcgggtgggtcatc
gggccgaaggacgtcgtcaaggccgcgaccaacctccagtcgcacgccacgtccaacgtg
gccaacgtgtcgcaggcggcggcgctggccgcggtctccggcaacctggacgccgtggcg
aagatgcgggaggccttcgaccggcgccgccagacgatcgtgcggatgctgaacgagatc
gacggcgtgctctgcccggagcccgagggcgcgttctacgcctacccgtcggtgaaggcg
ctgctcggcaaggagatccgcggcaagcgtccgcaggactcggtcgagctggccgcgctc
atcctggaggaggccgaggtcgcggtggtgcccggtgaggcgttcggcacgccggggtac
ctgcggctgtcgtacgcgctcggggacgaggacctcgtcgagggcgtgagccggatccag
aagctgctggcggaggcgcgggactga

DBGET integrated database retrieval system