KEGG   Streptomyces coelicolor: SCO4723Help
Entry
SCO4723           CDS       T00085                                 

Gene name
adk
Definition
(RefSeq) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00730  Thiamine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4723 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SCO4723 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO4723 (adk)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     SCO4723 (adk)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO4723 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 AAA_18 Cytidylate_kin Thymidylate_kin SRP54 AAA_28 zf-RRN7 AAA AAA_5 AAA_24 AAA_22 Mg_chelatase
Motif
Other DBs
NCBI-GeneID: 1100164
NCBI-ProteinID: NP_733646
Kitasato: SCO4723
UniProt: P43414
Position
5138968..5139621
Genome map
AA seq 217 aa AA seqDB search
MRIVLVGPPGAGKGTQATRLAETLHIPHISTGDLFRANISQQTELGKLAKSYMNAGNLVP
DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLETEGMKLDAVLDLEAPEDEV
VKRIAGRRVCRNEPKHVFHVTYTPPKKEGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT
EPIIDYYKSQGLVATIAATGPVDEVTRRALEALKRDQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgtcctcgtcgggcctccgggtgccggaaagggaacgcaggccacccgcctt
gccgagacgctgcacattccgcacatctccacgggcgacctgttccgcgcgaacatcagc
cagcagaccgaactgggcaagctcgcgaagtcctacatgaacgcgggcaacctcgtgccg
gacgaggtcaccatcgccatggcgaaggaccgcatggagcagcccgacgccgagggcggc
ttcctgctggacggcttcccgcgcaacgtctcccaggccgaggcgctggacgagctgctc
gagaccgagggcatgaagctcgacgcggtgctggacctggaggcccccgaggacgaggtc
gtcaagcggatcgccggccggcgcgtctgccgcaatgagccgaagcacgtcttccacgtg
acgtacacgccgccgaagaaggaaggcgtctgcgacgtctgcggcggcgagctgtaccag
cgggacgacgactccgaggagacggtccgcaagcggctggaggtctaccacacgcagacc
gagccgatcatcgactactacaagtcgcagggcctggtcgccaccatcgccgcgacgggc
cccgtggacgaggtcacccgccgcgcgctggaggcgctcaagcgcgaccagtag

DBGET integrated database retrieval system