KEGG   Streptomyces coelicolor: SCO4729Help
Entry
SCO4729           CDS       T00085                                 

Gene name
rpoA, SC6G4.07
Definition
(RefSeq) DNA-directed RNA polymerase subunit alpha
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
sco03020  RNA polymerase
Module
sco_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4729 (rpoA)
   00240 Pyrimidine metabolism
    SCO4729 (rpoA)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    SCO4729 (rpoA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sco03021]
    SCO4729 (rpoA)
   03400 DNA repair and recombination proteins [BR:sco03400]
    SCO4729 (rpoA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SCO4729 (rpoA)
Transcription machinery [BR:sco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     SCO4729 (rpoA)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      SCO4729 (rpoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_A_CTD RNA_pol_A_bac RNA_pol_L HHH_5
Motif
Other DBs
NCBI-GeneID: 1100170
NCBI-ProteinID: NP_628887
Kitasato: SCO4729
UniProt: P60312
Position
5142327..5143349
Genome map
AA seq 340 aa AA seqDB search
MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVL
HEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGPGLVTAADIAPPAGVEVHN
PDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIGRIPVDSIYSPVLKVTYKVEA
TRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLARELNIDAEGIDMGPSPTD
AALAADLALPIEELELTVRSYNCLKREGIHSVGELVARSEADLLDIRNFGAKSIDEVKAK
LAGMGLALKDSPPGFDPTAAADAFGADDDADAGFVETEQY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgctcagcgtccctcgttgaccgaagaggtcgtcgacgagttccgctcccgg
ttcgtcatcgagccgctggagccgggcttcggctacaccctcggcaactccctgcgccgg
accctcctgtcgtcgatcccgggtgcggcggtcacgtccatccgtatcgacggtgtcctg
cacgagttcaccaccgtgccgggcgtcaaggaggacgtcaccgacctgatcctcaacatc
aagcagctggtcgtctcctcggagcacgacgagccggtcgtgatgtacctgcgcaagcag
ggcccgggtctggtcaccgccgccgacatcgcgcccccggccggtgtcgaggtgcacaac
cccgacctcgtcctcgccacgctcaacggcaagggcaagctggagatggagctgaccgtc
gagcgcggtcgcggctacgtctccgccgtgcagaacaagcaggtcggtcaggagatcggg
cgcatcccggtcgactcgatctactcgccggttctcaaggtcacgtacaaggtcgaggcc
acgcgtgtcgagcagcgcaccgacttcgacaagctgatcgtcgacgtcgagaccaagcag
gccatgcgtccgcgcgacgccatggcgtcggccggcaagaccctggtcgagctgttcggt
ctcgcccgcgagctgaacatcgacgccgagggcatcgacatgggtccgtccccgacggac
gccgcgctggctgcggacctggctcttccgatcgaggagctggagctcaccgtccggtcg
tacaactgcctcaagcgcgagggcatccactccgtgggtgagctggtcgctcgctccgag
gcggacctgctcgacatccgcaacttcggtgcgaagtccatcgacgaggtcaaggccaag
ctggccggcatgggcctggccctcaaggacagcccgcccggattcgacccgaccgccgcc
gcggacgcgttcggtgccgatgacgatgctgacgccggtttcgtggagaccgagcagtac
tga

DBGET integrated database retrieval system