KEGG   Streptomyces coelicolor: SCO4740Help
Entry
SCO4740           CDS       T00085                                 

Gene name
glmS1, SC6G4.18
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
sco00250  Alanine, aspartate and glutamate metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO4740 (glmS1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4740 (glmS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sco01002]
    SCO4740 (glmS1)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SCO4740 (glmS1)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO4740 (glmS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 SIS_2 bact-PGI_C GATase_4
Motif
Other DBs
NCBI-GeneID: 1100181
NCBI-ProteinID: NP_628898
Kitasato: SCO4740
UniProt: O86781
Position
5153334..5155181
Genome map
AA seq 615 aa AA seqDB search
MCGIVGYVGPQSALDVVMAGLKRLEYRGYDSAGVAVLADGGLATAKRAGKLVNLDKELSE
HPLPAAATGIGHTRWATHGGPTDANAHPHLDNAGRVAVVHNGIIENFAPLRAELAERGHE
LPSETDTEVVAHLLAEEYSACADLAEAMRLVCGRLEGAFTLVAVHADAPDVVVGARRNSP
LVVGVGEGEYFLASDVAAFIAHTRDAVELGQDQVVELRRDGVRVTGFDGSPADVRSYHVD
WDASAAEKCGYASFMLKEIAEQPKAVADTLLGRIDGSGTLSLDEVRIPPGVLREVDKVVV
VACGTAFHAGLIAKYAIEHWTRIPCEVELASEFRYRDPILDQQTLVVAISQSGETMDTLM
ALRHAREQGARVLAICNTNGSTIPRESDAVLYTHAGPEVAVASTKAFLTQLVACYLVALY
LGQVRGTKYGDEIGDVVRDLSGISGAVERVLGTMDPVRQLARSLAHKNTVLFLGRHVGHP
VALEGALKLKELAYMHAEGFAAGELKHGPIALIEEDLPVVVVVPSPRGRSVLHDKIVSNI
QEIRARGARTIVIAEEGDEAVVPYADHLVRIPATPTLLQPLVATVPLQVFACELATARGN
EVDQPRNLAKSVTVE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtgggatacgtagggcctcagtcggcactcgatgtcgtgatggccgga
ctgaagcggctcgaataccggggatacgactcggcgggcgtcgccgtgctcgcggacggc
ggcctcgccaccgccaagcgggccggcaagctcgtcaatctcgacaaggaactgtccgaa
cacccgctgccggccgccgccaccggcatcggccacacccgctgggccacccacggcggc
cccaccgacgccaacgcccacccgcacctcgacaacgcgggccgggtggccgtcgtccac
aacggcatcatcgagaacttcgcgccgctgcgggccgagctggcggagcgcggccacgaa
ctgccctccgagaccgacaccgaggtcgtcgcccacctgctcgccgaggagtactcggcc
tgcgccgacctcgccgaggcgatgcggctggtgtgcggccgcctggagggcgcgttcacc
ctggtcgcggtgcacgcggacgcgccggacgtggtggtgggcgcgcgccgcaactcgccg
ctcgtggtgggggtgggggagggcgagtacttcctcgcctcggacgtcgcggccttcatc
gcccacacccgggacgccgtcgagctgggccaggaccaggtcgtcgaactgcgccgggac
ggcgtgcgggtcaccggcttcgacggctccccggcggacgtccgctcctaccacgtcgac
tgggacgcctcggccgccgagaagtgcggctacgcctccttcatgctcaaggagatcgcc
gagcagccgaaggccgtcgccgacaccctcctcggccgcatcgacggctccggcacgctg
agcctggacgaggtgcgcatcccgccgggggtgctccgggaggtcgacaaggtcgtcgtc
gtcgcctgcggtacggccttccacgccgggctgatcgccaagtacgccatcgagcactgg
acgcggatcccctgcgaggtggagctggccagcgagttccgctaccgcgacccgatcctc
gaccagcagaccctggtcgtcgcgatctcccagtccggcgagaccatggacaccctcatg
gccctgcgccacgcccgtgaacagggcgccagggtcctcgcgatctgcaacaccaacggc
tcgaccatcccccgcgagtccgacgccgtgctctacacccacgcgggccccgaggtcgcc
gtcgcctccaccaaggccttcctcacccagctcgtggcctgctacctggtcgccctctac
ctgggccaggtgcgcggcacgaagtacggcgacgagatcggcgacgtcgtccgcgacctg
tccggcatctccggcgcggtcgaacgggtcctggggaccatggacccggtgcgccaactg
gcccgctccctcgcccacaagaacacggtgctcttcctcggccggcacgtcggccacccc
gtcgccctcgaaggcgccctcaagctcaaggagctggcgtacatgcacgccgagggcttc
gcggcgggcgagctgaagcacgggccgatcgcgctgatcgaggaggacctgccggtcgtg
gtggtggtgccgtccccgcgcggccgctcggtgctgcacgacaagatcgtgtccaacatc
caggagatccgcgcccgcggcgcccgcaccatcgtcatcgccgaggagggcgacgaggcg
gtcgtcccctacgccgaccacctcgtccggatcccggccaccccgacgctgctgcaaccc
ctggtggccacggtgccgttgcaggtcttcgcctgcgaactggccacggcccgcggcaac
gaggtcgaccagccgcggaacctggcgaagtcggtgacggtggagtag

DBGET integrated database retrieval system