KEGG   Streptomyces coelicolor: SCO4770Help
Entry
SCO4770           CDS       T00085                                 

Gene name
guaB, SCD63.02
Definition
(RefSeq) inosine 5' monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4770 (guaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO4770 (guaB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     SCO4770 (guaB)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO4770 (guaB)
  Exosomal proteins of breast cancer cells
   SCO4770 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS His_biosynth FMN_dh NMO ThiG Glu_synthase
Motif
Other DBs
NCBI-GeneID: 1100211
NCBI-ProteinID: NP_628928
Kitasato: SCO4770
UniProt: Q9L0I7
Position
5181347..5182852
Genome map
AA seq 501 aa AA seqDB search
MTANVDGVPEKFATLGLTYDDVLLLPGASAVLPNAVDTSSRISRNVRVNIPLLSAAMDKV
TESRMAISMARQGGVGVLHRNLSIEDQANQVDLVKRSESGMVANPITIHPDATLGEADAL
CAKFRISGVPVTDGAGKLLGIVTNRDMAFETDRSRQVREVMTPMPLVTGQVGISGVDAME
LLRRHKIEKLPLVDGDGILKGLITVKDFVKAEQYPHAAKDAKGRLLVGAAVGASPEALDR
AQALAEAGVDFLVVDTSHGHNSNALSWMSKIKSSVGIDVVGGNVATRDGAQALIDAGVDG
IKVGVGPGSICTTRVVAGIGVPQVTAIYEASLAARAAGVPLIGDGGLQYSGDIGKALAAG
ADTVMLGSLLAGCEESPGELQFINGKQFKSYRGMGSLGAMQSRGQGRSYSKDRYFQAEVA
SDDKLVPEGIEGQVPYRGPLANVLHQLVGGLRQTMGYVGAATIEEMESKGRFVRITSAGL
KESHPHDIQMTVEAPNYSRSK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacgtcgacggagtgcccgagaaattcgcgacactcgggctgacctacgac
gacgtgctgctgctgccgggcgcctccgcggtgcttccgaacgcggtcgacacctcgtcc
cgcatctcccgcaacgtgcgggtcaacatcccgctgctctccgcggccatggacaaggtg
accgagtcccggatggccatctccatggcccgccagggcggcgtcggcgtcctgcaccgc
aacctgtccatcgaggaccaggccaaccaggtcgacctggtgaagcgctccgagtcgggc
atggtggccaaccccatcaccatccacccggacgccaccctcggcgaggccgacgccctg
tgcgccaagttccgcatcagcggcgtcccggtcaccgacggcgcgggcaagctgctcggc
atcgtcaccaaccgcgacatggccttcgagaccgaccgcagccggcaggtgcgcgaggtc
atgacgccgatgccgctggtcaccggccaggtcggcatctccggtgtggacgccatggag
ctgctgcgccgccacaagatcgagaagcttccgctggtcgacggcgacggcatcctcaag
ggcctgatcacggtcaaggacttcgtcaaggccgagcagtacccgcacgccgccaaggac
gccaagggccgcctgctcgtcggcgccgccgtcggcgccagccccgaggccctcgaccgc
gcccaggcgctcgccgaggcgggggtggacttcctcgtcgtcgacacctcgcacggccac
aacagcaacgcgctgagctggatgtcgaagatcaagtcgagcgtcggcatcgatgtcgtc
ggcggcaacgtcgccacccgcgacggcgcccaggccctgatcgacgccggcgtcgacggc
atcaaggtcggcgtcggccccggctccatctgcaccacccgcgtggtcgccggcatcggt
gtcccccaggtcaccgcgatctacgaggcctcgctcgcggcccgcgccgccggggtgccc
ctgatcggcgacggcggtctccagtactccggcgacatcggcaaggcgctcgccgccggt
gccgacaccgtgatgctgggcagcctgctggcgggctgcgaggagtcgccgggcgagttg
cagttcatcaacggcaagcagttcaagtcgtaccgcggcatgggctcgctgggcgccatg
cagtcccgcggccagggccggtcgtactcgaaggaccgctacttccaggccgaggtcgcc
tccgacgacaagctcgtgcccgagggcatcgagggccaggtcccctaccggggtccgctg
gccaacgtcctgcaccagctcgtcggcggtctgcgccagacgatgggctacgtgggcgcg
gccaccatcgaggagatggagtccaagggccgcttcgtccggatcacctccgcgggcctc
aaggagagccacccgcacgacatccagatgacggtcgaggcgccgaactacagccgcagc
aagtaa

DBGET integrated database retrieval system