KEGG   Streptomyces coelicolor: SCO4785Help
Entry
SCO4785           CDS       T00085                                 

Gene name
guaA
Definition
(RefSeq) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
Module
sco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4785 (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sco01002]
    SCO4785 (guaA)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     SCO4785 (guaA)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   SCO4785 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GMP_synt_C NAD_synthase Peptidase_C26 QueC tRNA_Me_trans ATP_bind_3 ThiI Asn_synthase Arginosuc_synth
Motif
Other DBs
NCBI-GeneID: 1100226
NCBI-ProteinID: NP_628943
Kitasato: SCO4785
UniProt: Q9L0H2
Position
5205166..5206746
Genome map
AA seq 526 aa AA seqDB search
MSSATPAAAAPDTVLVVDFGAQYAQLIARRVREARVYSEIVPSSMPVEEILAKNPAAIIL
SGGPSSVYEAGAPTLDRSLFEAGVPVFGMCYGFQLMAQTLGGTVDNSGAREYGRTELAVS
KPSSTLFEGTPAEQSVWMSHGDACSAAPEGFTVTGSTDVVPVAAFENDEKKLYGVQYHPE
VMHSTHGQQVLEHFLYRGAGLSPDWTTGNVIEEQVAAIRAQVGDRRAICGLSGGVDSAVA
AALVQKAIGSQLTCVYVDHGLMRKGETEQVEKDFVAATGVQLKVVDASERFLGALAGVSD
PEQKRKIIGREFIRVFEQAQLEIMREDGPEVAFLVQGTLYPDVVESGGGTGTANIKSHHN
VGGLPDDIEFELVEPLRQLFKDEVRMVGQELGLPDEIVQRQPFPGPGLGIRIVGEVTKER
LDLLREADAIAREELTAAGLDRDIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSED
AMTADWSRLPYEVLSKISTRITNEVTDVNRVVLDVTSKPPGTIEWE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcagcgactcccgctgccgccgcccccgacaccgtcctggtcgtcgacttcggc
gcgcagtacgcccagctcatcgcccgtcgtgtccgcgaggcgcgggtctacagcgagatc
gtgccgagctccatgccggtcgaggagatcctcgccaagaacccggcggccatcatcctc
tccggcggcccctcgtcggtgtacgaggcgggcgcccccaccctcgaccgctccctgttc
gaggccggcgtccccgtcttcggcatgtgctacggcttccagctgatggcgcagaccctc
ggcggcaccgtcgacaactccggcgcccgcgagtacggccgcaccgaactggccgtctcc
aagccgtcctccaccctcttcgagggcaccccggccgagcagtcggtgtggatgtcgcac
ggcgacgcctgctccgccgcccccgagggcttcaccgtcaccggctccacggacgtcgtc
ccggtcgccgccttcgagaacgacgagaagaagctctacggcgtccagtaccaccccgag
gtcatgcactccacgcacggccagcaggtgctggagcacttcctgtaccggggcgcgggc
ctgagccccgactggaccacgggcaacgtcatcgaggagcaggtcgcggccatccgcgcg
caggtcggcgacaggcgcgccatctgcgggctgtccggcggcgtggactccgcggtggcc
gccgcgctcgtccagaaggccatcggctcccagctgacctgcgtctacgtcgaccacggc
ctgatgcgcaagggcgagaccgagcaggtcgagaaggacttcgtcgccgcgaccggcgtg
cagctgaaggtcgtggacgccagtgagcggttcctgggcgcgctggccggggtgtccgac
cccgagcagaagcggaagatcatcggccgcgagttcatccgggtcttcgagcaggcccag
ctggagatcatgcgggaggacggcccggaggtcgccttcctggtgcagggcacgctctac
ccggacgtcgtcgagtccggcggcggcaccggcaccgccaacatcaagtcccaccacaac
gtgggcgggctcccggacgacatcgagttcgagctggtcgagccgctgcgccagctgttc
aaggacgaggtccggatggtcggccaggagctgggcctgccggacgagatcgtccagcgc
cagccgttcccgggcccgggcctcggcatccggatcgtcggcgaggtcaccaaggagcgg
ctcgacctgctgcgcgaggccgacgccatcgcccgcgaggagctgaccgcggccggcctc
gaccgcgacatctggcagtgcccggtggtgctgctcgcggacgtccgctccgtcggcgtc
cagggcgacggccgcacctacggccacccgatcgtcctgcggccggtctcgtccgaggac
gccatgacggccgactggtcccggctgccgtacgaggtgctctccaagatctcgacccgg
atcaccaacgaggtcacggacgtcaaccgcgtcgtcctcgacgtgacctcgaaacccccg
ggcacgatcgagtgggagtga

DBGET integrated database retrieval system